KEGG   Rhizobium sp. IE4771: IE4771_CH03106Help
Entry
IE4771_CH03106    CDS       T03310                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00473  D-Alanine metabolism
rei00550  Peptidoglycan biosynthesis
rei01100  Metabolic pathways
rei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IE4771_CH03106 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IE4771_CH03106 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    IE4771_CH03106 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rei01011]
    IE4771_CH03106 (ddl)
Enzymes [BR:rei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IE4771_CH03106 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rei01011]
 Precursor biosynthesis
  Amino acid ligase
   IE4771_CH03106 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 CPSase_L_D2 B12-binding
Motif
Other DBs
NCBI-ProteinID: AIC28197
UniProt: A0A060I303
LinkDB All DBs
Position
complement(3070159..3071085)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAAALEAEGFKVTCIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAAAAGIPVAESQVVNR
FAFPSAHPMRPPYVVKPVREGSSFGVVIVTEDQAHPPQVVSSPEWHYGEDVLVERYVYGR
ELTCGVMGETALGVTEVVPLGHNFYDYDSKYAVGGSKHVIPAKISPNIYQKIQTLALRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaacggcccgtcagc
ctttcctcgggaaaggcttgcgcagcagccctcgaagccgaaggcttcaaggtgacgtgc
atcgatgtcgcgcgcgacgtttccgagaagcttgcggcgttgaagcctgatgtcgtcttc
aacgcacttcacggccccttcggcgaagatggtacgattcagggcatcctcgaatatctc
gaaattccctatacgcattcgggcgtgctcgcctcggcgttggcgatggacaaggacaag
gcaaagcttgtcgctgccgctgccggcattccggttgccgaatcacaggtcgtcaaccgt
ttcgcctttccttcagcgcatccgatgaggccgccctatgtggtgaagccggttcgcgaa
gggtcgagcttcggcgtcgtcatcgtcacggaagatcaggcgcatccgccgcaggtcgtc
agctcgcccgagtggcactatggcgaggacgttcttgtcgagcgctatgtctacggccgc
gaactgacctgcggtgtcatgggcgagactgcgcttggcgtcaccgaggtggtgccgctg
ggacacaatttctatgattacgattccaagtatgcggtgggcggttcaaaacacgtcatc
ccggcgaaaatttcaccgaatatttaccaaaaaatacaaacattggccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttctcc
gaagacggcgaaatcatctggctggaggtcaatacccagcctggcatgactccaacctcg
ctcgtgcccgaaatggccggccatgccggttattcctttggtgaatttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system