KEGG   Rhizobium sp. IE4771: IE4771_CH03230Help
Entry
IE4771_CH03230    CDS       T03310                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
Organism
rei  Rhizobium sp. IE4771
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIC28316
UniProt: A0A060I9J8
LinkDB All DBs
Position
3194702..3195730
Genome map
AA seq 342 aa AA seqDB search
MKAVRLQAIGQLQLCEIEKPAPAPGELLVRVEACGICGTDRHIFHGEFPSKAPVTLGHEF
AGIIETIGPGVTGFRPGMRVTGDPNISCGGCEECRRGRVNLCRNLRAIGIHRDGGFAEYV
CMPQTQAFALPADLDPLHGAFCEPLACCIHGVDLAGLKTGSSAIVLGGGVIGLLTLQLAR
LAGATRILLVTRSAEKRRLAESLGATTTVDPGDGDLIARITAENGLLPGGGDVVFECAGV
AETMQQAPRLARRGGTAVILGVMPQGATIEIEPFDLLFREVALISSFVNPFTHGRAADLV
ASGRIKVEPLISRRIGLEEAPEAITNPARGGEIRVLVVPGGK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcgtctgcaagcaattggacagttgcaactctgcgaaatcgaaaaaccc
gcacccgcccccggtgaattgctggtccgcgtcgaagcctgcggcatttgcggcaccgac
cgtcacatctttcacggtgaattcccatcgaaggcgccggtgacgctcggacatgaattc
gccgggatcatcgagacgatcgggccaggcgtgactggtttccgccccggcatgcgcgtg
accggcgatccgaacatatcttgcggcggctgcgaggaatgccggcgcggccgcgtcaat
ctctgccggaacttgcgggcgatcggcattcaccgcgacggcggcttcgccgaatatgtc
tgcatgcctcaaacgcaggctttcgcgttgccggccgatctcgatccgctccacggcgcc
ttctgcgagccgctcgcctgctgcattcacggcgtcgatctcgccgggctgaaaaccggc
tcgtcggccatcgtgctcggcggtggcgtcatcggcctgctcacgcttcaactggcgcgg
cttgccggtgcgacccgtatcttgctggtgacccgcagcgccgaaaagcggcggctggcc
gaaagcctcggcgccactaccacagtcgatcccggggatggcgatctcattgcccgcatc
accgctgagaacgggctgctgcccggcggcggcgatgtcgtcttcgaatgcgccggcgtg
gcagagaccatgcagcaggcgcctcggcttgcccggcgcggcggcaccgccgtcattctc
ggcgtcatgccgcagggtgccacgatcgagatcgaacccttcgacctgctgtttcgcgaa
gtcgcgctgataagctccttcgtcaaccccttcacccatggccgcgccgccgacctcgtc
gcctccggcaggatcaaggtcgagccactgatatccaggcggatcgggctcgaggaggcc
ccggaagcgatcaccaatccggcgcgcggcggcgaaatccgcgtccttgtcgtacccggc
ggtaaatag

DBGET integrated database retrieval system