KEGG   Rhizobium sp. IE4771: IE4771_CH03342Help
Entry
IE4771_CH03342    CDS       T03310                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00240  Pyrimidine metabolism
rei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IE4771_CH03342 (tdk)
Enzymes [BR:rei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IE4771_CH03342 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AIC28425
UniProt: A0A060I8U1
LinkDB All DBs
Position
complement(3311131..3311733)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFKLIAGLCRDGAPISCVFVDEAHFMTAVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAHGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactattcgacgatgaacgccggcaagtcgacgctgctgctg
caggcctcctacaattatcaggagcgcggcatgcgtacggtgcagctgattgccgccttc
gacgagcgcgccggccggggcgtcatcggctcgaggatcgggctggaagcgagcgccatc
cccttcgagccgcacgaagatctgttcaagctcatcgccgggctgtgccgcgacggggcg
ccgatttcctgcgtcttcgtcgacgaggcgcatttcatgacggccgtccatgtctggcag
cttgcccgtgtcgtcgatcggctcggcatccctgtcatggtctatgggctccggaccgac
ttccagggcaaactgtttccggcttcgcaggagttgctggcgatcgctgacgagatgcgc
gaagtgcgcacgatctgccattgcggccgtaaggcgacgatggttgtgcggctcgacgcc
cacggcaaggtgctgcacgagggcgcgcagatcgatgtcggcggtaacgagaaatatgtc
tcgctctgccgcaggcactgggacgacgaaatgaacggcgcctggatcgcggagccggtc
tga

DBGET integrated database retrieval system