KEGG   Rhizobium sp. IE4771: IE4771_CH04051Help
Entry
IE4771_CH04051    CDS       T03310                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD(+)) protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00010  Glycolysis / Gluconeogenesis
rei00620  Pyruvate metabolism
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
rei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IE4771_CH04051
   00620 Pyruvate metabolism
    IE4771_CH04051
Enzymes [BR:rei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IE4771_CH04051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIC29112
UniProt: A0A060I5J5
LinkDB All DBs
Position
4045804..4047312
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWRDPVEGKYFENLTPVTGGKLCDIPRSDEKDINLALDA
AHAAKEKWGRTSAAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAGDIPLAIDH
FRYFASCIRAQEGSIGEIDNDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNC
VVLKPAEQTPASILLWAELVGDLLPPGVLNIVNGFGIEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKALEGFAMFALNQGEVCTCP
SRALVQESIYERFMEKAVKRVEAIKQGNPLDSATMIGAQASTEQLEKILAYLDIGKQEGA
EVLAGGSRNELGGDLANGYYVKPTIFKGHNKMRIFQEEIFGPVVSVTTFKDEREALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LEHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcagaaaatcgtcgaatcgccgttcaagctgaagtacggcaactatattggc
ggcgaatggcgcgacccggtcgaaggcaagtatttcgaaaacctgacaccggtcaccggc
ggcaagctatgcgacattccccgttccgatgaaaaggacatcaatctcgcgctcgacgcc
gcccatgcggccaaggaaaaatggggccgcacttccgctgccgagcgctctaacatcctc
atgaagatcgcccagcgcatggaagacaagctggaattgcttgcccaggccgagacctgg
gacaatggcaagccgatccgcgaaaccatggcgggcgacattccgctggcgatcgaccac
ttccgctatttcgcctcctgcatccgtgcccaggaaggctcgatcggcgagatcgacaat
gataccgtcgcctatcacttccacgaaccgctcggcgtcgttggccagatcattccatgg
aacttcccgatcctgatggccacgtggaagcttgcgccggcgcttgccgctggcaactgc
gtcgtgctgaagcccgccgagcagaccccggcttcgatcctgctctgggcggaactggtc
ggcgatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggcatcgaggccggc
aagccgctggcgaccagcccccgcatcgccaagatcgccttcaccggcgagacgacgaca
ggccggctgatcatgcaatatgccagccagaacctcattccggtgacgctggagctcggc
ggcaaatcgcccaacatcttcttcgccgatgtgatggccgaggatgacgacttcctcgac
aaggcgctcgaaggttttgcgatgtttgccctcaaccagggcgaagtctgcacctgcccg
agccgcgccctcgtccaggaatcgatctacgagcgcttcatggaaaaggcggtcaaacgt
gtcgaggcaatcaagcagggcaacccgctcgacagcgcgacgatgatcggcgcccaggcc
tcgacggagcagctcgaaaagatcctcgcctatctcgacatcggcaagcaggaaggcgcc
gaagttctggctggcggctcccgcaacgaactcggcggcgatctggcgaacggctattac
gtcaagccgacgatcttcaagggccacaacaagatgcgcatcttccaggaggagatcttc
gggccggtggtctcggtcacgactttcaaggacgagagggaagcgctcgaaatcgccaac
gacacgctctacggtctcggcgccggcgtctggagccgcgacgccaatcgctgctatcgg
ttcggccgcgagatccaggccggccgcgtctggaccaactgctaccacgcctaccccgcc
catgccgcgtttggcggctacaagcagtcgggcattggccgcgaaacccacaagatgatg
ctcgagcactaccagcagaccaagaacatgctggtgagctacagcccgaaggcgcttggc
ttcttctga

DBGET integrated database retrieval system