KEGG   Rhizobium sp. IE4771: IE4771_CH04214Help
Entry
IE4771_CH04214    CDS       T03310                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00020  Citrate cycle (TCA cycle)
rei00310  Lysine degradation
rei00380  Tryptophan metabolism
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
rei01120  Microbial metabolism in diverse environments
rei01130  Biosynthesis of antibiotics
rei01200  Carbon metabolism
Module
rei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IE4771_CH04214 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    IE4771_CH04214 (sucA)
   00380 Tryptophan metabolism
    IE4771_CH04214 (sucA)
Enzymes [BR:rei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     IE4771_CH04214 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIC29263
UniProt: A0A060I263
LinkDB All DBs
Position
complement(4208044..4211028)
Genome map
AA seq 994 aa AA seqDB search
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPASVDDQWRAFFKALEEDPADVKKAA
KGASWRKKHWPLAAGGDLVSALDGNWGIVEKAIETKVKAKAEAAGKPADTTDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAATVDDYHELSPENYGFTSADYDRKIFIDNVLGLE
YATIREMIEILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGVAFSAEGKKAILAKL
IEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKRGGHLGLKEAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFDGNKVHVSLTANPSHLE
IVDPVVMGKVRAKQDMSATVWEGDIIPLSERAKVLPLLIHGDAAFAGQGVIAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPILHVNGDDPEAVVYAAKI
ATEFRMKFHKPVVVDMFCYRRYGHNEGDEPSFTQPKMYKVIRGHKTVLQLYAERLVREGL
LTDGEVEKMKADWRAHLEQEFEAGQSYKPNKADWLDGEWSGLRTADNADEQRRGKTAVPM
KTLKEIGRKLSEIPAGFHAHRTIQRFMENRANMIATGEGIDWAMAEALSFGALCLEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AEMAGESAFHRLLWDDAEVIKDGPIKLQKDNKIRRVVMCSGKVYYDLLEEREKRGIDDVY
LLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPFLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagaagccaacgagcagtttcagatcacctcgtttctggatggcgccaac
gcggcctatatcgagcagctctatgcgcgctacgaagaggatccggcatcggtcgacgat
caatggcgcgccttcttcaaggcgctggaagaggatcctgctgatgtgaagaaggcggcc
aagggagcctcctggcgcaagaagcactggccgctggccgccggcggcgatctggtgtcg
gcgctcgacggcaattggggcatcgtcgagaaggcgatcgaaaccaaggtgaaggcgaag
gccgaagccgccggcaagccggccgacaccaccgacgtgctgcaggcgacgcgcgattcg
gtgcgcgccatcatgatgatccgcgcctatcgcatgcgcggccatctgcacgccaagctc
gatccactcggcatcgccgctaccgtcgacgactatcatgagctgtcgccggaaaattac
ggtttcacatcagccgattacgatcgcaagatcttcatcgacaacgtgctcggcctggaa
tacgcgaccatccgcgagatgatcgagatcctcgagcgcacctactgctcgacgctcggc
gtcgaattcatgcatatctccaatccggaggagaaggcttggatccaggagcgcatcgaa
gggccagacaagggcgtcgccttctcggccgaaggcaagaaggcgatccttgccaagctc
atcgaagccgagggttacgagcagttcctcgacgtcaagttcaagggcaccaagcgtttc
ggtctcgacggcggtgaatcgctgatccccgcactggaacagatcctgaagcgcggcggc
catctcggccttaaggaagcggtattcggcatggcccatcgcggccgtctgaacgtgctc
tcccaggtgatgggcaagccgcaccgcgccatcttccacgagttcaagggcggttcctat
gcgcctgacgaagtcgaaggttccggcgacgtgaagtaccatctgggcgcttcctccgac
cgcgaattcgacggcaacaaggtgcacgtctcgctgacggcaaatccgtcgcatctcgaa
atcgtcgatccagtcgtcatgggcaaggttcgcgccaagcaggacatgagcgctacggta
tgggaaggcgacatcattccgctgtctgaacgcgccaaggtgctgccgttgctgatccac
ggcgacgcggccttcgccggccagggcgtcattgccgaaattctcggcctatccggtctg
cgcggccaccgtgtcgccggcaccatgcacgtcatcatcaacaaccagatcggcttcact
acgaacccggccttttcgcgctcgtcgccctatccgtctgatgtcgccaagatgatcgag
gcgccgatcctgcacgtcaacggcgacgatccggaagccgtggtctacgcagccaagatt
gcgaccgaattccgcatgaagttccacaagccggttgtggtcgacatgttctgctatcgc
cgctacggccataacgaaggcgatgaaccgtccttcacgcagccgaagatgtacaaggtc
atccgcggccacaagacggtgctgcagctttatgcagagcgcctggttcgcgaaggcctg
ctcacggatggcgaagtcgaaaagatgaaggccgactggcgcgcgcatctcgagcaggag
ttcgaggccggccagagctacaagccgaacaaggccgactggctggacggcgagtggtcg
ggcctgcgcaccgccgacaatgccgacgagcagcggcgcggtaagaccgccgtgccgatg
aagacgctgaaggagatcggccgcaagctctcggagatcccggcaggcttccatgcacac
cgcacgatccagcgcttcatggaaaaccgggccaacatgatcgccaccggcgagggcatc
gactgggcgatggcagaagcgctctccttcggcgcgctttgcctcgaaggccacaagatc
cgcctgtccggccaggattgcgagcgcggcaccttctcgcagcgccactcggttctctac
gatcaggagaccgaggagcgttacattccgctcgccaatctttcgccgacgcaggcgcgc
tacgaagtcatcaactcgatgctttcggaagaggccgtgctcggcttcgaatacggctac
tcgctcgcccgtccgaatgcgctgacgctttgggaagcgcagttcggcgatttcgccaac
ggtgcgcaggtggtcttcgaccagttcatctcgtcgggcgaacgcaagtggctgcgcatg
tccggcctcgtctgcctgctgccgcacggctatgagggccaaggtccggagcactcctcg
gctcgcttggagcgcttcctgcagctctgcgcggaagacaatatgcaggtcgccaacgtc
acgacgccggcgaactacttccacatcctgcgccggcagctgaagcgcgacttccgcaag
ccgctgatcctgatgacgccgaaatcgctgctgcgccacaagcgggcggtctcgacgctg
gccgaaatggccggtgaatccgccttccatcgcctgctctgggacgatgccgaggtgatc
aaggacggcccgatcaagctgcagaaggacaataagatccgccgcgtcgtcatgtgctcc
ggcaaggtctattacgatcttctggaagagcgtgaaaagcgcggtatcgacgacgtctat
ctgctgcgcgtcgaacaactctatccgttcccggcaaaggcgctcatcaacgagctgtcg
cgcttccgcaacgccgagatggtctggtgccaggaagagccgaagaacatgggcgcatgg
tcgttcatcgaccccttcctcgaatgggtgcttgcccatatcgatgcgaagtaccagcgc
gtccgctataccggccgtccggccgccgcctcaccggcgacgggcctgatgtccaagcat
ctgtcgcagctcgcagcattcctcgaggatgcattaggcggctaa

DBGET integrated database retrieval system