KEGG   Rhizobium sp. IE4771: IE4771_PA00099Help
Entry
IE4771_PA00099    CDS       T03310                                 

Definition
(GenBank) ribulose bisphosphate carboxylase/oxygenase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00630  Glyoxylate and dicarboxylate metabolism
rei01100  Metabolic pathways
rei01120  Microbial metabolism in diverse environments
rei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    IE4771_PA00099
Enzymes [BR:rei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     IE4771_PA00099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIC29605
UniProt: A0A060IC32
LinkDB All DBs
Position
pRetIE4771a:108876..110159
Genome map
AA seq 427 aa AA seqDB search
MDLAQRRPSDILVTYRIETAGSAEALAVKIGSDQSTGTFVDLPGETPQLKARAAARVVAF
EKLDSVEVPSLPAAGEVFNRAETTIAYPLEAVGTDLAAVTTVALGGVWSIKEFTGLRVVG
LQLPPEFEGVYPGPQFGIEGSRRLTGVYNRPIIGTIIKPALGLTPDETAQVVAELVASGV
DFIKDDEKLMSPPYSSLEARVKAIMPIVRDQEQRTGKKVMYAFGISDVDPDEMVRKHDLV
VREGGNAAVININSIGMGAFLFLRRRSSLVLHAHRNGWDLLTRHPGLGFDFSVYQQLWRL
LGVDQFQINGIAAKYWEPDASFVQSFHDLQKPIFSDADRPLPVVCSGQWGGQAPETYRRT
EQTLDHLYLCGGGVVSHPGGPSAGVRAVRAAWDAAVAGIDLHEYAKSHPELAQSLAKFGS
KTVSEGR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatctggctcagcgcaggccctcggacattctggtcacctatcggattgagaccgcc
gggagcgctgaggccttggcggtcaagatcggaagcgaccagtcgacgggtacatttgtt
gacctgccgggagagacgccgcaactgaaggcgcgcgcggccgcgcgcgtggtcgctttc
gagaaactggactctgtcgaggttccctcgctccctgcagcgggcgaagtcttcaaccga
gcggagacaacaatcgcctatcccctggaggccgtcggaactgaccttgcggcagtcacc
acggttgcattgggcggggtctggtcgatcaaggaattcaccgggctgagggtcgtcggc
ctgcagctgcctccagagtttgaaggcgtctacccggggcctcaatttgggatcgaaggc
tcccggcgtctgaccggcgtctacaataggccaatcatcggcacgatcatcaagcccgcg
ctcggcctcaccccggacgaaacggcgcaggtggttgctgaactcgtcgcgtccggtgtc
gacttcatcaaggacgacgagaaactgatgtcgccaccgtactcctcgttggaggcgcgg
gtgaaagcgatcatgccgatcgtccgggatcaggagcagcgcaccggcaagaaggtgatg
tatgccttcggcatttccgacgtcgatcccgacgagatggttcgcaagcacgacctggtc
gtgcgcgagggtggaaacgccgccgtcatcaacatcaattcgatcggcatgggcgccttt
ctgttcctgcgtcggcggtcgtcccttgtcttgcacgcccatcgcaacggctgggatctt
ctcacccgacatcctggtcttgggttcgatttctcggtctaccaacagctttggcgactt
ctcggcgtcgaccaattccagatcaacggcattgccgccaaatactgggagccggacgcg
tctttcgttcagtcgttccatgatctccagaaaccgatcttcagtgatgccgaccgcccg
ttaccggtcgtttgttcgggtcaatggggtggacaggcgcctgagacctatcgaaggacg
gagcagacgcttgaccacctttacctttgtggtggtggcgtcgtcagccatcccggcggg
ccgtcggcgggtgtcagagcggttcgtgcggcctgggatgccgcggtcgccggaatcgat
ctccatgaatatgccaaatctcatccagagctggcgcagtcgctcgccaagttcggctct
aaaaccgtatcagaaggaagatga

DBGET integrated database retrieval system