KEGG   Rhizobium sp. IE4771: IE4771_PC00215Help
Entry
IE4771_PC00215    CDS       T03310                                 

Definition
(GenBank) D-xylulose reductase protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00040  Pentose and glucuronate interconversions
rei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IE4771_PC00215
Enzymes [BR:rei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     IE4771_PC00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AIC30340
UniProt: A0A060IE74
LinkDB All DBs
Position
pRetIE4771c:243360..244403
Genome map
AA seq 347 aa AA seqDB search
MTKVRALVLERQHELALRDIDLPLETGPGQVKIKIHTVGVCGSDVHYYTHGKIGPFVVNA
PMVLGHEAAGTVVEVGAGVTHLKAGDRVCMEPGIPDPNSKASRLGLYNIDPAVTFWATPP
VHGVLTPEVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAASKAKITPGDTAIVLGAGPI
GTMVAIAALAGGCARAIVADLAQPKLDIAAQYQGVIPVNIRETNLIEEVGRLTDGWGADV
VFECSGSPKAWETIMALPRPGGVIVAVGLPVNPVGFDVSTATTKEIRIETVFRYAHQYER
AIALLGSGRVDLKPLISETFTFEDSIKAFDRAVEARPSDVKLQIVME
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtccgtgcgctggtgctggagcgccagcatgaacttgcgcttcgcgatatc
gatctgccgctggagacaggaccggggcaggtcaagatcaagattcataccgtcggcgtt
tgcggctcggacgtgcattattatactcacggcaagatcggtcccttcgtcgtaaacgcg
ccgatggtgctcggccatgaggcggccggcacggtggtcgaggtcggggctggcgtcacg
catctgaaagccggcgaccgcgtctgcatggagcccggcattcccgatccgaattccaag
gcaagccggctcggcctgtataatatcgatcccgccgtaacattctgggcgacgccgccg
gtccatggcgtgctgacgccagaggtcgtgcatcccgccaactatacgttcaagctgccc
gacaatgtcagctttgccgaaggcgcgatggtcgagcccttcgcggtcggcatgcaggcg
gcgagcaaggccaagattacgccgggtgataccgccatcgttcttggcgccgggccgatc
ggcacgatggtggcgatcgcggcgctcgccggcggctgcgcccgggcgatcgttgccgat
ctcgcccagccgaagctcgatatcgccgcgcagtaccagggtgtcattccggtcaatatc
cgcgaaacgaatctgatcgaagaagtgggcaggctgaccgacggctggggcgccgacgtc
gtcttcgaatgctccggttcgccgaaagcctgggagacgatcatggcgctgccgcgcccg
ggcggcgtcatcgtcgccgtcggcctgccggtcaatcctgttggtttcgacgtctcgacg
gcaacgaccaaggagatccgcatcgaaacggtgttccgttacgcccatcagtatgagcgc
gcgatcgcgctgctcggctcggggcgcgtcgacctgaagccgctgatatcagagaccttc
acattcgaggattcgatcaaggccttcgatcgcgccgtcgaggcccggccgagcgatgtg
aagctgcagatcgtcatggagtag

DBGET integrated database retrieval system