KEGG   Rhizobium sp. IE4771: IE4771_PD00497Help
Entry
IE4771_PD00497    CDS       T03310                                 

Gene name
dadX
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00473  D-Alanine metabolism
rei01100  Metabolic pathways
rei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IE4771_PD00497 (dadX)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    IE4771_PD00497 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rei01011]
    IE4771_PD00497 (dadX)
Enzymes [BR:rei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IE4771_PD00497 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rei01011]
 Precursor biosynthesis
  Racemase
   IE4771_PD00497 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIC31052
UniProt: A0A060IBD5
LinkDB All DBs
Position
pRetIE4771d:complement(523961..525094)
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSRARTATITQGATGYLTIDLAALGRNYSKLASMLAPVRAGAVVKADAYGLGAE
RVAQTLYDQGCRHFFVAQFVEAVRLRPALAEGAQIFVLNGLQPGNELACAESGIIPVLNS
LAQWRQWSATARRLKRSLPAVLQFDTGMSRLGFPWEERAELAAAIRDGVNVEILFIMSHL
ACADELESSQNGEQIAEMARIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAP
NAGGNNPMEPVVRLDVAVVQTRTVPSGAKIGYGGAHVTRRQTRLATIAAGYADGLPRSLG
DRGAVYHKGIRLPIVGRVSMDSTTVDITALPEGALSLGSLVEVLGPNQTLDDVAGDAGTI
SYEILTGLGDRYDRQYC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttggtttcccgcgcacgcaccgctacgatcacgcagggagccacg
ggctatctgacgatcgatcttgccgcgctcggccgcaattattcgaagcttgcatcgatg
ctggcgccggtccgcgcgggagccgtcgtcaaggccgatgcttatggcctcggcgccgag
cgggtcgcccaaacgctctacgatcaggggtgcaggcatttcttcgtcgcccagttcgtc
gaggccgtaaggctgcggccggcccttgctgagggtgctcagatattcgtgctgaacggc
ttgcagcccggcaacgagctcgcctgcgccgaaagcggcattattccggttctcaattcg
ctcgcgcagtggcggcaatggtcggcgaccgcgcgtcggctgaagcgcagcctgccggcc
gttctgcagttcgacaccggcatgtcgcggctcggttttccctgggaagagcgagccgaa
ttggcggcagccatccgcgacggcgtcaatgtcgaaatcctgttcatcatgagccacctg
gcctgcgccgacgagctggagagcagccagaacggcgaacagattgccgagatggcgcgc
attgccgatgaatttcccggcttcgatatctccttcgccaattccggcggcgtctttctc
ggcgatgcctatcatggtgtgctcgcccgcccgggcatcgccctttatggcggcgcaccg
aatgccggcggcaacaacccgatggaaccggtcgtcaggctggatgtcgcggtcgtgcag
acgcgcaccgtaccttcaggcgccaagatcggttatggcggcgcgcatgtgacgcgcagg
caaacccgcctcgccaccatcgccgccggttacgccgacggcctgccgcgcagtctcggc
gaccgcggcgccgtttatcacaagggcatccgtctgccgatcgtggggcgcgtgtcgatg
gacagcacgaccgtcgacatcacggctttgcccgaaggggcgctgagcctcggcagcctc
gtcgaagtgcttggtcccaaccagacgctcgatgacgtggctggcgatgccggaacgata
tcttacgaaatactaaccggtctgggcgatcgttacgacaggcaatattgctga

DBGET integrated database retrieval system