KEGG   Rhizobium sp. IE4771: IE4771_PE00343Help
Entry
IE4771_PE00343    CDS       T03310                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00564  Glycerophospholipid metabolism
rei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IE4771_PE00343 (glpD)
Enzymes [BR:rei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IE4771_PE00343 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AIC31567
UniProt: A0A060ICY0
LinkDB All DBs
Position
pRetIE4771e:357879..359393
Genome map
AA seq 504 aa AA seqDB search
MGREIHDIFVIGGGINGCGIARDAVGRGYTVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGAVILPRTKVVS
ARRETGLWHIETTDTVTGRSESHQARMLVNAAGPWVDHVIRSAFGENEAHHVRLVQGSHI
VVKKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLDGERETAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGNFAVKGYEAEVAKLKGRYPFLADRH
ARRLVRRYGTRAETLLGNARGIDDLGRLFGGDLYEAEVAYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatacacgacattttcgtcattggcggcggcatcaacggctgcggcatc
gctcgcgatgctgtcgggcgcggctataccgtggcgctggcggagatgaacgatttcgct
tcgggcacctcatctggcgccaccaagctgatccatggcggcctgcgttatctcgagcat
tacgagttccgcctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcatatcatctggccgctacgcttcgtattgccttatcataagggcggtatccgcccg
gcatggctgatccggctcggtctcttcctctacgaccatctcggcggccgcaagctgctg
ccggcgacgtcggtgctcgacatgcgcaaggatccggccggcaagccactgaaggcgctg
tttacgagagcgttcgaatattccgacggctgggttgacgacgctcgcatggtggtgctg
aacgcccgcgatgccgccgacaagggtgcggtcatactgccgcgtaccaaagtggtgtcg
gcacggcgcgagacgggcctttggcatatcgagaccaccgataccgtcaccggccgcagc
gaaagccatcaggcgcggatgctggtcaatgccgccggtccctgggtcgatcatgtcatt
cgttccgccttcggcgagaacgaggcccaccatgtccgcctcgtccagggcagccatatc
gtcgtcaagaagaagttcgacgatccgcgcgcctatttcttccagaatccggacaatcgc
atcatcttcgccattccctatgagggcgacttcaccctgatcggcacgaccgaccgcgac
tataccgccgatcccaaggatgtcaggatctccgaggaggagacggtctatctctgcaat
gcggcgtcggaatatttcaaggagccggtgcggccagaggatatcgtctggacctattcg
gcggtgcgcccgctttatgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagctcgacggcgagagggagaccgcgccgctgcttaatgttttcggcggcaag
ctcaccacttatcgccggctgtccgagcatgcgttggagaagatcggtgctgcgatcggc
gtcaagggtgctccgtggacggccaagagccatctgcccggcggcaatttcgccgtcaag
ggttatgaggccgaggttgccaagctgaaaggccgctatccgttcctcgccgatcggcac
gctcgccggctggtgcgtcgctacggcaccagggccgagacgctactcggcaatgcccgt
ggcattgacgatctcgggcggctgttcggcggcgatctctacgaggccgaggtcgcctat
ctcgtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggagcaggctcagtcactggaggagtacatggctgccatgccg
gcgatggccggatag

DBGET integrated database retrieval system