KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01168Help
Entry
REMIM1_CH01168    CDS       T02778                                 

Definition
(GenBank) ATP-dependent DNA ligase protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel03030  DNA replication
rel03410  Base excision repair
rel03420  Nucleotide excision repair
rel03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    REMIM1_CH01168
   03410 Base excision repair
    REMIM1_CH01168
   03420 Nucleotide excision repair
    REMIM1_CH01168
   03430 Mismatch repair
    REMIM1_CH01168
Enzymes [BR:rel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     REMIM1_CH01168
    6.5.1.6  DNA ligase (ATP or NAD+)
     REMIM1_CH01168
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     REMIM1_CH01168
DNA replication proteins [BR:rel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    REMIM1_CH01168
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     REMIM1_CH01168
DNA repair and recombination proteins [BR:rel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     REMIM1_CH01168
   NER (nucleotide excision repair)
    Other NER factors
     REMIM1_CH01168
   MMR (mismatch exicision repair)
    Other MMR factors
     REMIM1_CH01168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AGS21009
UniProt: S5SGJ6
LinkDB All DBs
Position
1190383..1192008
Genome map
AA seq 541 aa AA seqDB search
MKAFADLLDRLVLTPSRNGKLKLLTDYFRDTPDPDRGYGLAAIAGTLEVRNVKPAMLREL
VLERMDEVLFHYSYDYVGDLAETISLVWDNERDIDRSALAQPRLGEVVTRMNGLGRTEVR
GYVRDLLDRLDSSGRFAFIKLATGALRIGVSARLAKQALADLGGKDVAEIETLWHGLQPP
YETLFQWLAGGGDKPALASPAIFHSVMLANAVEEGDLTGLDPADYAAEWKWDGIRVQLSR
SGDRRKIYSRSGDDISGAFPDILEAINFSGVVDGELLVGGTARSNSPTRTFSDLQQRLNR
KTVTAKMLDDYPAFIRAYDMLFDGEEDIRGRNYVDRRERLSDIIDRAPHDRFDLSPLVPF
SSWEELDALRAAPPDPVIEGVMIKRRDSIYQAGRMKGPWFKWKRNPYNVDAVLMYAQRGH
GKRSSYYSDFTFGVWADDEDGEQLVPVGKAYFGFTDAELELLDKFVRNNTTERFGPVRAV
RADREFGFVVEVAFEGINRSTRHKSGVAMRFPRIARLRPDKPPYEADRLRTLIAMIDAKP
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgacctgctcgaccgtctggttctgacccccagccgcaacggcaaa
ctcaagctgctgaccgattatttccgcgacacgcccgatccggaccgcggctacggcctt
gcggcgatcgccggcactctggaggtgcgcaacgtcaagcccgccatgctgcgcgagctg
gtgctggagcgcatggacgaggtgctgttccactattcctatgattatgtcggcgatctc
gcggagaccatctcgctcgtctgggacaatgagcgggatatcgaccgctcggcgcttgcc
cagccacgcctgggcgaggtcgtcacccgcatgaacggtctcggccgcaccgaagtgcgc
ggctatgtccgcgatctgctcgaccggctggattcctccggccgcttcgccttcatcaag
cttgcgaccggcgcgcttagaatcggcgtttccgcccgtcttgccaagcaggccttggcc
gatctcggcggcaaggacgtcgccgagatcgagacactctggcacggcctgcagccgcct
tacgagacgctgttccaatggctggcgggcggcggcgacaaaccggccctggcttcaccg
gcgatcttccattcggtcatgctcgccaatgcggtggaggagggggacctgacaggtctc
gacccggccgactatgccgccgaatggaaatgggacggcattcgcgttcagctttcccgc
tccggcgaccggcgcaagatctattcccgctccggcgacgacatatcgggcgcctttccc
gatattctcgaggcgatcaatttttccggcgtcgtcgacggcgagctgctggtcggcggc
actgcccgctccaacagcccgacccgcaccttttccgatctgcagcagcggctgaaccgc
aagacggtgacggcgaagatgctcgacgactaccccgccttcatccgcgcctatgacatg
cttttcgacggcgaggaggatattcgcggccgcaactatgtcgatcgccgcgagcgtctt
tccgatatcatcgaccgcgccccccatgaccggttcgacctctcgccgctcgtgcctttc
tcctcatgggaggagctcgacgctctgcgtgccgccccgcccgatccggtcatcgagggc
gtgatgatcaagcggcgcgacagcatctaccaggccgggcggatgaaaggcccgtggttc
aagtggaagcgtaatccctataatgtcgatgcagtgctgatgtatgcacagcgcggccac
ggcaagcgctccagctattattccgatttcaccttcggcgtctgggccgatgacgaggac
ggcgaacagctggtgccggtgggaaaggcctatttcggtttcaccgatgccgagctcgag
ctgctcgacaaattcgtgcgcaacaatacgaccgagcgtttcgggccggtgcgggcggtg
cgggccgacagggagttcggcttcgtcgtcgaggtggccttcgagggtatcaaccgctcg
acgcggcacaaatcgggggtcgcaatgcgcttcccccgcatcgctcgccttcgccccgac
aaacctccgtatgaggccgaccggctgcgcacgctgatcgccatgatcgacgccaagccc
ggctga

DBGET integrated database retrieval system