KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01994Help
Entry
REMIM1_CH01994    CDS       T02778                                 

Gene name
pdhC-1
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex 1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00010  Glycolysis / Gluconeogenesis
rel00020  Citrate cycle (TCA cycle)
rel00620  Pyruvate metabolism
rel01100  Metabolic pathways
rel01110  Biosynthesis of secondary metabolites
rel01120  Microbial metabolism in diverse environments
rel01130  Biosynthesis of antibiotics
rel01200  Carbon metabolism
Module
rel_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REMIM1_CH01994 (pdhC-1)
   00020 Citrate cycle (TCA cycle)
    REMIM1_CH01994 (pdhC-1)
   00620 Pyruvate metabolism
    REMIM1_CH01994 (pdhC-1)
Enzymes [BR:rel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     REMIM1_CH01994 (pdhC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N HlyD_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: AGS21783
UniProt: S5RV93
LinkDB All DBs
Position
1976840..1978192
Genome map
AA seq 450 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAASAPKADAAPAKAEAAPAA
APAPTAAPAAVSAGGNRTFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDIEAALAGGA
KPAPAPAAASAPQAVAPAPAAAPKGASDDAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVSVDCELDALMALRAQLNDAAPRKENAPAYKLSVNDMVIKAMALALRDVPDAN
VSWTDSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSAISNEMRDLGKRAKDRKLKP
EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLS
TDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagctgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggtaccgaaggcgtcaaggtcaatgcgctgatcgccgttctcgcggccgat
ggcgaggatgtcgccgctgccgcaagcggcgcgggttccgctgctccggccaaggctgag
gctgcatctgcgccgaaagccgacgctgcgccagcgaaggctgaggccgctccggccgcg
gcaccggcacctaccgctgcacccgcggccgtttcggctggtggcaaccgcaccttttct
tcgccgctcgcacgccgcctggccaaggaagccggcatcgacctttcggccgtcgccggt
tctggtccgcatggccgcgtgatcaagagcgatatcgaagctgcccttgccggcggcgcc
aagcccgctccggcgcctgccgctgcttcggctccgcaggctgtcgcgccggctcctgcc
gccgcgccgaagggcgcttccgatgatgccgttctcaagctgttcgagccgggctcctac
gagctcgtcccgcatgacggcatgcgcaagacgattgcccggcgcctggtcgagtcgaag
cagacgatcccgcatttctatgtcagcgtcgattgcgagctcgatgcgctgatggcgctg
cgcgcccagctcaacgatgcggcgccgcgcaaggaaaacgcgccggcctacaagctctcg
gtcaacgacatggtgatcaaggccatggcgctagcattgcgcgacgttccggacgccaat
gtgtcgtggaccgacagcaacatggtcaagcacaagcacgccgacgtcggcgtcgccgtc
tcgatccccggcggcctgatcaccccgatcattcgcaaggccgaacagaagacgctgtct
gccatctccaacgagatgcgcgatctcggcaagcgcgccaaggaccgcaagctgaagccc
gaggaatatcagggaggcaccagctcggtctcgaacatgggcatgatgggcgtcaagaat
ttcgccgccgtcgtcaacccgccgcatgcgacgatcctcgcagttggcgccggggagcag
cgggtcgtcgtcaagaacggcgaaatggcaattgccaccgtgatgtcggtgacgctgtca
accgaccatcgttgcgtcgacggtgcgctcggcgccgagctcctccaggccttcaagggc
tacatcgaaaacccgatgggcatgctcgtctaa

DBGET integrated database retrieval system