KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH02270Help
Entry
REMIM1_CH02270    CDS       T02778                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00500  Starch and sucrose metabolism
rel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_CH02270 (treS)
Enzymes [BR:rel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     REMIM1_CH02270 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     REMIM1_CH02270 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AGS22052
UniProt: S5SIV0
LinkDB All DBs
Position
2254583..2256244
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVESFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFEDARSDPH
SRYREWYVWSDKKPANADQGMVFPGVQKTTWTYDEKAKGYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRLGDSIV
LAEANILPKDNFEYFGEDGDRMQMMFNFQVNQTLFYALATADTRPLKKAMDATKPRPATA
QWGLFLRNHDELDLGRLTDKQRDAVFAAFGPEKEMQLYDRGIRRRLAPMLGGDRRRIELA
YSLLFSLPGTPVIRYGDEIGMGDDLCLPERNCARTPMQWSTEPEGGFTKSAKPVSPVIKD
GPYGFEHINVAVQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSAVDTGDDGVLALRYDWR
GNSVLILHNLHPHPTEVTFDPDVGELGRLLIDIADGASSEADEKGRHTVMLDAYGYRWYR
VGGLDYLLRRKDI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgccgtcatctactgcctgtccgtcgagagcttc
atggatgcgaacggcgacggtgtgggcgatttccagggcctgatgcgccgtctcgactat
ctctccggcctcggcgtgacggcgatctggctcatgccgttccagacgtcgcccggtcgg
gacgacggctacgacgtctccgattactacaatgtcgacccacgctatggctcgctcggc
gatttcgtcgagttcacccatggtgccaaacagcggggcatccgggtgttgatcgatctg
gtgatcaatcacacctccaaggatcatccctggttcgaagacgctaggagcgacccgcat
tcacgctatcgcgagtggtacgtctggtcagacaaaaagcccgccaacgcggatcagggc
atggttttcccgggcgtccagaaaaccacctggacctatgacgaaaaagccaagggctat
tattttcaccgcttctacgatcaccagcccgatctcaacacgtccaatcccgaggtgcag
gcggagatcctcaagatcatgggcttctggatccagctcggcgtctcgggcttccgcatg
gacgccgcccccttcatcatcgccaccaagggcgcagaggtcaccaagccggtcgagcag
ttcgacatgctgaggaaatttcgcgaattcctgcaatggcgactgggagattccatcgtg
ctggcggaggccaatatcctgccgaaggataatttcgaatatttcggcgaagatggcgac
cgcatgcagatgatgttcaatttccaggtcaaccagacgctgttttatgctctcgccacg
gccgacacgcggcctctgaagaaggctatggatgccacgaagccgcgcccggcaaccgcg
caatggggtctatttcttcgcaaccacgatgaactggatctcggtcgcctgacggataag
cagcgcgatgcggtattcgcggcatttggacccgagaaggaaatgcaactttacgacagg
ggcattcgccgtcgcctcgcgcctatgctcggcggcgaccgccgcaggatcgagttggcc
tacagcctgctgttctcgctgcccggaacgccggtcatccgctacggcgatgaaatcggc
atgggcgatgatctgtgcctgccggagcgcaattgcgcgcgcaccccgatgcaatggtcg
acggaaccggaaggcggtttcaccaaaagcgcgaagcccgtttcgcctgttatcaaggac
ggcccctacggcttcgagcatatcaatgtcgccgtccagcggcgcgacccgaattcgctc
ttgaactggaccgagcggatgatccggatgcgcaaggaggctcccgagatcggctggggc
gatttctcagcggtcgatacaggtgacgacggcgtactggcgctgcgttatgactggcgc
ggcaattcggtgctgatcctgcacaacctgcatccgcacccgaccgaagtgaccttcgat
cctgatgttggtgaactcgggcgattgctgatcgatattgccgatggggcaagtagcgaa
gccgacgaaaaagggcgccatacggtcatgctcgatgcctatggctatcgctggtatcgc
gtcggcggcctcgactatctcctcaggcggaaagatatttag

DBGET integrated database retrieval system