KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH02331Help
Entry
REMIM1_CH02331    CDS       T02778                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    REMIM1_CH02331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rel02000]
    REMIM1_CH02331
Enzymes [BR:rel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     REMIM1_CH02331
Transporters [BR:rel02000]
 Other Transporters
  Pores ion channels [TC:1]
   REMIM1_CH02331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AGS22112
UniProt: S5SJ23
LinkDB All DBs
Position
2312586..2313212
Genome map
AA seq 208 aa AA seqDB search
MAEELVFYTNPMSRGRIARWMLEEIGRPYRTELLTFGESMKAPEYLRVNPMGKVPAIRHG
NTVVTECAAICAYLAETFPEKGLAPRPEERARYYRWMFFAAGPLESAVTMKALGFEIPTE
RLRMAGCGGFGDVMNTLEMAVSGSTYVTGERFTAADVYVGAHIGWGLGFGSIEKRQAFVD
YFGRISQRDAYKRANALDDEAGKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaattggtattctacacgaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccggccctaccgcaccgaactcctgaccttcggtgaaagcatg
aaggcgccggaatatctccgtgtcaatccgatgggcaaggtgccggcaatccgccacggc
aacaccgtggtcactgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggccccaagaccggaggagcgcgcgcgctattaccgctggatgttctttgct
gccggtccactggaatcggcggtgacgatgaaggcgctcggtttcgaaattccgacggag
cgcctgcgcatggccggctgcggcggtttcggcgacgtcatgaacacgctcgaaatggcc
gtttccggctcgacttatgtcaccggcgagcgcttcaccgccgccgacgtctatgtcggc
gcgcatatcggctggggcctcggcttcggttccatcgaaaaacgccaggcgttcgtcgat
tacttcggccgcatcagccagcgtgacgcctataagcgcgccaatgcactggacgacgag
gccggcaagacgatgcaggccgcctga

DBGET integrated database retrieval system