KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH02499Help
Entry
REMIM1_CH02499    CDS       T02778                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00061  Fatty acid biosynthesis
rel00780  Biotin metabolism
rel01100  Metabolic pathways
rel01212  Fatty acid metabolism
Module
rel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    REMIM1_CH02499
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    REMIM1_CH02499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rel01004]
    REMIM1_CH02499
Enzymes [BR:rel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     REMIM1_CH02499
Lipid biosynthesis proteins [BR:rel01004]
 Fatty acid synthase
  Component type
   REMIM1_CH02499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AGS22273
UniProt: S5RWQ8
LinkDB All DBs
Position
complement(2484237..2484719)
Genome map
AA seq 160 aa AA seqDB search
MLLEYFQMIDRVEAVDLKKGILSARSVVPAKSPVFEGHFPGMPLVPGVLLIEAMAQASGM
LVLAATDFAAMPFLMSVDGAKMRTFVEPEAVLDIEAVLEHDGSGFAVTKAKITSGGKKVC
DAQLKLRTMPFSEVPLGDIVKKRAGEVGLLEAIAAQGVIE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaatatttccagatgattgaccgcgtagaagcggtggacctgaagaagggg
atactttcggcgcgatccgtcgtgccggcaaagagtcccgttttcgagggccattttccc
ggcatgccgctcgttccaggtgtgctcctgatcgaggccatggcgcaggcctccggtatg
ctggtgcttgccgctaccgattttgccgccatgcccttcctgatgtcggtcgacggcgcg
aagatgcgcaccttcgtcgagccggaagccgtgctcgacatcgaggcggtgctggagcac
gacggttccggttttgcggtcaccaaggccaagatcaccagcggcggcaagaaggtctgc
gacgcgcaactgaaactgcgtaccatgcccttcagcgaggtgccgctcggcgatatcgtg
aaaaaacgcgccggcgaagtcgggcttctcgaagcgatcgcagcgcagggagtgattgaa
tga

DBGET integrated database retrieval system