KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH03004Help
Entry
REMIM1_CH03004    CDS       T02778                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
Organism
rel  Rhizobium etli bv. mimosae Mim1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AGS22759
UniProt: S5SM29
LinkDB All DBs
Position
2980731..2981759
Genome map
AA seq 342 aa AA seqDB search
MKAVRLQATGQLRLCEVEKPAPGPGELLVRVEACGICGTDRHIFHGEFPSKPPVTLGHEF
AGIVETVGPGVTDFRPGMRVTGDPNISCGGCEECRRGRVNLCRNLQAIGIHRDGGFADYV
CMPQSQAFALPADLDPLHGAFCEPLACCIHGVDLAGLHAGASVIVLGGGVIGLLTLQLAR
LAGATRLVLVTRSREKRRLAESLGATATADPGDGDVIAHITAADGPLPGGADVVFECAGV
TETMQQAPRLARRGGSAVILGVMPQGARIEVEPFDLLFREVRLIASFVNPFTHGRAADLI
ATGRIKVEPLISRRIGLSEAPDAIINPARGGEIRALVIPGRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgcgcctgcaagcgacaggacagttacggctttgcgaagtcgaaaagcca
gcacccggccccggcgaattgctggtccgcgtcgaagcctgcggcatctgcggcaccgac
cgccatatcttccacggcgaatttccgtcgaagccgccggtgacgctcggccatgaattc
gcaggtatcgtcgagacggtcggaccgggcgtgaccgatttccggcccggcatgcgcgtg
accggcgatccgaacatttcctgcggcggctgcgaggaatgccgccgcggccgggtcaat
ctctgccggaacctgcaggcgatcggcattcaccgcgacggcggctttgccgattatgtc
tgcatgccgcaaagccaggccttcgcactgccggccgatcttgacccgctccacggcgcc
ttctgcgagcccctcgcctgctgcattcacggcgtcgacctcgcaggattgcatgccggc
gcttcagtcatcgtgctcggcggcggcgtgatcggcctgctcaccctccagctggccagg
cttgccggcgcgacgcgcctcgtgctggtgacgcggagccgcgaaaaacgccgcttggcc
gaaagcctcggcgccaccgcgacggctgatcccggtgacggcgatgtcattgcccacatc
actgccgcagacggaccgctgcccggcggcgccgacgtcgtcttcgaatgcgccggcgtc
actgaaaccatgcagcaggcgccccggcttgcccgccgcggcggcagcgccgtcattctc
ggcgtcatgccgcagggggcaaggatagaagtcgagcccttcgacctgctgtttcgcgaa
gtccggctgatagcctccttcgtcaacccttttacccatggccgcgccgccgatttgatc
gccaccggcaggatcaaggtcgagccgttgatctcccgaaggatcggactttcagaagcc
ccggacgcgatcatcaatccggcgcgcggcggcgaaatccgggcgctcgtcatccccgga
cgaaaatag

DBGET integrated database retrieval system