KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH03778Help
Entry
REMIM1_CH03778    CDS       T02778                                 

Definition
(GenBank) adenylate cyclase protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00230  Purine metabolism
rel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    REMIM1_CH03778
Enzymes [BR:rel01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     REMIM1_CH03778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc Sdh5
Motif
Other DBs
NCBI-ProteinID: AGS23505
UniProt: S5S131
LinkDB All DBs
Position
complement(3799301..3800518)
Genome map
AA seq 405 aa AA seqDB search
MDYSDVSTIAAWVTEQGLKGVSEAELMTGFCAACRDAGLPLDRGMALMDTLHPVHEGRAF
RWDSVEEIETEFEYGPTSSGEAAANWQRSAFYHLWSRNERELRRRLGFGDPIDFAMLDKI
AEAGHTDFVAMMHRFSEAGTIGEMDCFFSHFATKHPEGFSDHDLAVLRKLVPVLGLAIKC
IALGRIARTIAEVYLGEDAARQVMEGKISRGKSERISAALWFSDLLNYTKISDRVPPEEI
IPLLNDYSEVAISAIHEAGGNVLKLIGDGVLAIFKGEVPAETCQAALRAESLLREKLVKL
NAARAADGRATTDVYIGLHIGDVFYGNIGSQDRLDFTVIGPAVNEVSRIASMCRSVDLNL
LISSDFAAAIPAEERTALACVGRYALRGVQRAQELYTLDSARLNG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggattacagcgacgttagcacgattgcggcctgggttacggagcagggactgaagggc
gtttcggaagccgagctcatgaccggtttctgtgcggcctgccgggatgccgggctgccg
ctcgaccgcggcatggcgctgatggacacgctgcaccccgtgcatgaaggccgcgccttc
cgctgggacagcgtggaggagatcgaaaccgaattcgaatatggcccgacgagttcgggt
gaagcggcggcgaattggcagcgctcggccttctaccatctttggtcgcgtaacgagcgg
gagctacgccgacgcctgggcttcggcgatccgatcgatttcgccatgctcgacaagatc
gccgaagccggccacacggatttcgtggcgatgatgcatcgtttcagcgaagccggcacg
atcggcgagatggattgcttcttctcgcatttcgcaaccaaacatcccgagggtttctcc
gatcacgatctcgccgtcctgcgcaagctggtgccggtcctcggactggcaatcaagtgc
attgcgctcgggcgcatcgcccgcaccatcgcagaagtctatctcggggaggatgcggcg
cgccaggtgatggaaggcaagatcagccgcggcaaatcggaacggatctcggcggcgctg
tggttttccgatctgttgaactacaccaagatttccgaccgtgtgccgcctgaggaaatc
atcccgctgctcaacgattacagcgaggtggccatctcggcgattcacgaggccggcggc
aatgtgctgaagctgatcggcgacggcgtgctcgccatcttcaagggggaggtgccagcc
gagacctgccaggcggcgctcagggccgaatcgctgctgcgggaaaagctcgtcaagttg
aacgcggcgcgcgcggccgacgggcgggcgacgacggacgtctatatcggcctgcatatc
ggcgacgtcttctacggcaatatcggcagccaggaccggttggacttcaccgtcatcggc
cccgccgtcaacgaggtcagtaggattgcctcgatgtgtcgttcggtcgacctcaacctg
ctgatctcctcggatttcgccgccgccataccagcggaagagcggaccgcgcttgcctgc
gtcggacgttatgcgcttcgcggcgtgcagcgcgcacaggaactctacacgctcgacagc
gctcgcctgaacggttga

DBGET integrated database retrieval system