KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PA00022Help
Entry
REMIM1_PA00022    CDS       T02778                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00564  Glycerophospholipid metabolism
rel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    REMIM1_PA00022 (glpD)
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     REMIM1_PA00022 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGS23974
UniProt: S5SQI5
LinkDB All DBs
Position
pRetMIM1a:19559..21073
Genome map
AA seq 504 aa AA seqDB search
MSREIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGATIMPRTKVVS
ARRENGLWHIETTDTVTGRDDSHRARMLINAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
VVRKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLFDDGASKAQEATRDYVLKLEGEAGAAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGDFPVRGYEAEVAGLKRRYPFLADAH
ARRLVRRYGTRAVTLLGAARGLDDLGRLFGGDLYEAEVKYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAIPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgggagatacacgacatattcgtcatcggcggaggcatcaacggctgcggcatc
gcgcgcgacgccgttgggcgcggctattccgtcgcgctggcggagatgaacgatttcgcc
tccggcacctcgtcgggagcgaccaagctgattcatggcggcctgcgttatctcgagcat
tatgaattccgcctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcacattatctggccgctgcgcttcgtattgccttatcataagggcggcattcgcccg
gcctggctgatccggctcggccttttcctttacgatcatcttggcggccgcaagctactg
ccggcgacctccgtgctcgacatgcgcaaggacccggccggcaaaccgctgaaagcgctg
ttcacaagggcgttcgaatattccgacggctgggtcgatgatgcccgcatggtcgtgttg
aacgcccgcgacgctgccgacaaaggggcgacgatcatgccgcgcaccaaagtggtgtcg
gcgcgacgcgagaatggtctctggcacattgaaacgaccgatacggtcactggccgcgat
gacagccatcgggcccgcatgctgatcaacgccgccggtccctgggtcgatcatgtcatc
cgttccgccttcggccagaacgaggcccaccacgttcgtctcgttcagggtagccatatc
gtcgtcaggaagaagttcgacgacccccgtgcctatttcttccagaatcccgacaaccgc
atcatcttcgcaatcccctatgagggtgacttcaccctgatcggcaccaccgaccgcgac
tacactgccgatcccaaagatgtccggatctccgaggaggagacggtctatctctgcaat
gccgcgtcggaatatttcaaagaaccggtcaggccggaggacatcgtctggacctactcg
gcagtcagaccgctttttgacgacggcgcctcgaaggcgcaggaggcgacgcgcgattat
gtgctgaagctggaaggcgaagccggggccgcgccgctgctcaacgtcttcggcggcaag
ctcaccacctatcgtcggctttctgagcatgcgctggagaagatcggcgccgcgatcggc
gtcaagggtgctccttggacggccaaaagccatctgcccggcggcgactttccggttcgt
ggctacgaagcggaggtcgccggtcttaagcggcgctatccgttccttgccgatgcacac
gcccgccggctggtgcgccgttacggcacgcgggctgtgactctgcttggcgctgcccgc
ggccttgacgacctcgggcggctgttcggcggcgatctctacgaggccgaggtcaaatat
ctcgttgagcatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggaacaggcccagtcactggaggagtacatggctgccataccg
gcgatggccggatag

DBGET integrated database retrieval system