KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00046Help
Entry
REMIM1_PF00046    CDS       T02778                                 

Definition
(GenBank) ribulose bisphosphate carboxylase/oxygenase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00630  Glyoxylate and dicarboxylate metabolism
rel01100  Metabolic pathways
rel01120  Microbial metabolism in diverse environments
rel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    REMIM1_PF00046
Enzymes [BR:rel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     REMIM1_PF00046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGS25717
UniProt: S5SUY7
LinkDB All DBs
Position
pRetMIM1f:complement(43355..44608)
Genome map
AA seq 417 aa AA seqDB search
MITLTYRIETPGSVEAMAHKIASDQSTGTFVPVPGETEELKSRVAARVLAIRPLEDARHP
TWPEALAGTLLHRADVDIAFPLEAIGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPEAF
RSAHPGPQFGIPGSRRLTGVEGRPIIGTIVKPALGLRPHETAELVGELIESGVDFIKDDE
KLMSPAYSPLKERVAAIMPRILDHEQKTGKKVMYAFGISHADPDEMMRNHDIVAAAGGNC
AVVNINSIGFGGMSFLRKRSSLVLHAHRNGWDVLTRDPGAGMDFKVYQQFWRLLGVDQFQ
INGIRVKYWEPDDSFVASFEAVSTPLFDAADCPLPVAGSGQWGGQAPETYERTGRTIDLL
YLCGGGIVSHPGGPAAGVRAVQQAWQAAVAGIPLEVYAKDHPELAASIAKFSDGKGA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgataaccctgacctaccgcatcgaaacgcccggcagcgtcgaggcgatggcgcacaag
atcgccagcgaccagtcgaccggaaccttcgtgccggttcccggcgagacggaagagctg
aaatcgcgcgtcgccgcccgggttctggcgatccgaccgctcgaggatgcgcgccatccg
acctggcccgaggcattggccggcacgctgctccaccgcgccgatgtcgacatcgccttc
ccgctggaggcgatcggcaccgatctttcggcgttgatgactatcgcgatcggcggcgtc
tattcgatcaaaggcatgaccggcatccgcatcgtcgatatgaaactgcccgaggccttc
cggagtgcccatcccggaccgcagttcggcataccgggcagccgccgcctcaccggcgtc
gagggccggccgatcatcggcacgatcgtcaagccggcgctggggctgaggccgcacgag
acggcggaactcgtcggggaactgatcgagtcgggcgtcgacttcatcaaggacgatgag
aagctgatgagcccggcctattcgccgctcaaggagcgcgttgccgcgatcatgccgcgc
attctcgatcacgagcagaagaccggcaagaaggtcatgtacgccttcggcatctcgcat
gccgatccggacgagatgatgcgcaaccacgatatcgtcgccgcggccggcggcaattgc
gccgtcgtcaacatcaactcgatcggcttcggcggcatgagcttcctgcgcaagcgctcc
agcctggtgctgcatgcgcatcgcaacggctgggacgtgctgacgcgcgatccgggcgcc
ggcatggatttcaaggtctatcagcagttctggcggctgctcggcgtcgaccagtttcag
atcaacggcatcagggtcaaatattgggagccggacgacagcttcgtcgcctcgttcgag
gccgtcagcacgccgctcttcgatgccgccgattgcccgcttccggtcgcgggctccggc
cagtggggcgggcaggcgccggagacctacgagcgcaccggccgcaccatcgatcttctc
tatctctgcggcggcggcatcgtcagccatccgggcggtcctgcggccggtgtgcgcgcc
gtgcagcaggcctggcaggcggcggtcgccggcataccgctggaggtctacgccaaggac
catccggagcttgccgcctcgatcgccaagttcagcgacggcaagggcgcgtga

DBGET integrated database retrieval system