KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00423Help
Entry
REMIM1_PF00423    CDS       T02778                                 

Gene name
nrtB
Definition
(GenBank) nitrate ABC transporter permease protein NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00910  Nitrogen metabolism
rel02010  ABC transporters
Module
rel_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    REMIM1_PF00423 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    REMIM1_PF00423 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rel02000]
    REMIM1_PF00423 (nrtB)
Transporters [BR:rel02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    REMIM1_PF00423 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGS26089
UniProt: S5SX67
LinkDB All DBs
Position
pRetMIM1f:complement(450164..451057)
Genome map
AA seq 297 aa AA seqDB search
MSALANKETPSIVASAKPAAKVLSFSGKQGSRIDFRRAALATLHNVVPPAVVLALILILW
QALCSSADASLPSPHQVWQDSYDLIAYPFFNYGSQDIGLGWRVLVSLQRVAYGFGLAAVA
GVIVGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAEVLRLNQFEFFWKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGIVGFALDKLVAALGKLVTRGAMAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctggcaaataaagaaactccctcgatcgtcgcctctgccaagccggcggcg
aaggttctgtcattctccggcaagcaaggatcgcgcattgattttcgccgtgcggcgcta
gccacactccacaatgtcgtgccgccggctgtcgtgctcgcactcattcttatcctctgg
caggcgctctgttcatcggcggacgcctctctgccttcgccgcatcaggtctggcaggat
agctacgacctcatcgcctacccgttcttcaactacggctcccaggatatcgggctcggc
tggcgcgtgctggtctcgctgcagcgcgttgcttacggcttcggcctcgccgccgtcgcc
ggcgtcatcgtcggggcgatcatcggccaatcggtctgggcgatgcgcggtctcgatccg
atctttcaggtgctgcgtacggtgccgccgctcgcttggctgccgctgtcgctcgcggcc
ttccaggattccaatccttcggcaattttcgtcatcttcatcacctcgatctggcctgtc
atcatcaataccgcggtcggcgtccgcaatattccgcaggattatcgcaacgtcgccgag
gtactgcggctcaaccagttcgaattcttctggaagatcatgctgccgtcggcagcccct
tacatcttcaccggcctcaggatcggcgtcggcctctcctggctcgccatcgtcgcggct
gaaatgctgaccggcggcgtcggtatcggcttcttcatctgggacgcgtggaactcctcg
cgccttcccgacatcatcgtcgcgctcgcctatatcggcatcgtcggctttgccctcgac
aagctggtggctgcgctcggcaaactcgtcacccgcggcgccatggccaactaa

DBGET integrated database retrieval system