KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00435Help
Entry
REMIM1_PF00435    CDS       T02778                                 

Definition
(GenBank) glycosyde hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00500  Starch and sucrose metabolism
rel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_PF00435
Enzymes [BR:rel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     REMIM1_PF00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGS26101
UniProt: S5SFL0
LinkDB All DBs
Position
pRetMIM1f:complement(465445..466872)
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGANPAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PTSPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPVPGGVLPS
LVDYVNFAALCQANAKNSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLDG
ATQTIAKQLVQANLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGITVP
AGVADAISWLESQLATHWNGQLYVSILDAAEQAGYDANIDIVSSVCYGGIEPTDTKLLAT
AAILRRQWADPSSSNYYPVNGADAAKGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANAIDASGAIPLDQFSEPFFAELGLGASSSASDASAALRASSDAMLRAIVYH
SDHYELSEQFDGTVGYEKSVRNLTWSYASFLSAVRARAAAPAAKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcgaacccggcccatatcggcgcc
aatgcgcctacagtcaaaccgaggcctgccttcgcgcagaccgatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
cccacatcgcccggcgtcttttcggccccgggctgcgtcatcgccgcaccctcctatcca
gcaaacacgccgggtgtcgaccaggactatgttttcaactgggtccgcgacggggccatt
acggccatcgagatcgcgcttgccggcttgttacccgttccgggcggagttttgccgagc
ctggtcgactacgtgaacttcgccgcgctctgccaggcgaatgcgaagaattccgacacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgacgggccggccattcagtcgattgcgatcctgaccctgttcgatcagctggatggc
gccacgcagacgatcgccaaacaactggtccaggccaacctcgcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatatgagggctattcgtttttcgcaaga
gccgtacagctccgctttttccgggaaatttccacaaacacgatcggcattacggtgcct
gccggggtggccgacgccatctcctggctggaaagccagctggcaacccactggaacggg
cagctctatgtgagcattttggatgccgcggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccaaccgataccaagcttctggcaacg
gcggccatcctgcggcgccagtgggccgatccttcgtcttcgaactattaccccgtcaat
ggcgccgacgcggccaaagggctcggaccactcttcgggcgctatccaggcgaccattac
gatggcgatgtggcggctccggttgccggcgggcatccctgggctttgtgcaccgccaac
ttcgccgagtttcaatatcggcttgccaatgccatcgatgccagcggcgccatccccctc
gatcagttctccgaacccttcttcgcggaactgggacttggcgcatccagcagcgcttcc
gacgcgtcggctgccttgcgggcttcctctgacgccatgctgcgcgccatcgtctatcac
agcgatcactatgaactgagcgaacagttcgatggaaccgtcggctacgagaaaagcgtc
cggaatctgacctggagctatgcctccttcctctcggcagtcagagcccgcgccgccgcc
ccggccgccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system