KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00440Help
Entry
REMIM1_PF00440    CDS       T02778                                 

Gene name
dadX-2
Definition
(GenBank) alanine racemase 2
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00473  D-Alanine metabolism
rel01100  Metabolic pathways
rel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    REMIM1_PF00440 (dadX-2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    REMIM1_PF00440 (dadX-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rel01011]
    REMIM1_PF00440 (dadX-2)
Enzymes [BR:rel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     REMIM1_PF00440 (dadX-2)
Peptidoglycan biosynthesis and degradation proteins [BR:rel01011]
 Precursor biosynthesis
  Racemase
   REMIM1_PF00440 (dadX-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGS26106
UniProt: S5SFL5
LinkDB All DBs
Position
pRetMIM1f:469774..470907
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSRRRTATITQGATGYLTIDLAALGRNYSKLASMLAPVRAGAVVKADAYGLGAE
RVAQTLYDQGCRHFFVAQFVEAVRLRPALAKAAQIFVLNGLQPGSELACAESGIVPVLNS
LAQWRQWSATARRLQRSLPAVLQFDTGMSRLGFPEEERAGLAAAIRDGANVEILFIMSHL
ACADDLESSQNGEQIAEMARIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAP
NAGGKNPMEPVVRLDVAVVQTRTVPSGTKIGYGGAYVTRRQTRLATIAAGYADGLPRSLG
ERGAVYHKGIRLPIVGRVSMDSATVDITALPEGALSLGSLVEVLGPNQTLEDVAGDAGTI
SYEILTGLGDRYDRHYC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttggtttcccgcagacgcaccgctacgatcacgcagggagccacg
ggctatctgacgatcgatcttgccgcgctcggccgcaattattcgaagcttgcatcgatg
ctcgcgccggtccgcgcgggcgccgtcgtcaaggcagacgcttatggtctcggcgccgag
cgggtcgcccaaacgctatatgatcagggctgcaggcatttcttcgtcgcccagttcgtc
gaggccgtgaggctgcggccggcccttgctaaggctgcgcagatattcgtgctgaacggc
ttgcagcccggcagcgagctcgcctgcgccgaaagcggcatcgttccggttctcaattcg
ctcgcgcagtggcggcaatggtcggcgacggcgcgccggttgcagcgcagcctgccggcc
gttctgcagtttgacaccggcatgtcgcggctcggttttcccgaggaagagagagccgga
ttggcggcagcaatccgcgacggcgccaatgtcgaaatcctgttcatcatgagccacctg
gcctgcgccgacgacctggagagcagccagaacggcgaacagattgccgagatggcgcgc
attgccgatgaatttcccggtttcgacatctccttcgccaattccggcggcgtctttctc
ggcgatgcctatcatggtgtgctcgcccgcccgggcatcgccctttatggcggcgcaccg
aatgccggcggcaagaacccgatggaaccggtcgtcaggctggatgtcgcggtcgtgcag
acgcgcaccgtaccttcaggcaccaagatcggctatggcggcgcgtatgtgacgcgaagg
caaacccgcctcgccaccattgccgccggttacgccgacggcctgccgcgcagtctcggc
gagcgcggcgccgtttatcacaagggcatccgtctgccgatcgtggggcgcgtgtcgatg
gacagcgcgaccgtcgacatcactgctttgcccgaaggggcgctgagcctcgggagcctc
gtcgaagtgcttggtcccaaccagacgctcgaagacgtggctggcgatgccggaacgata
tcttacgaaatactaaccggtttgggcgatcgttacgacaggcactattgctga

DBGET integrated database retrieval system