KEGG   Rickettsiales endosymbiont of Stachyamoeba lipophora: EF513_03330Help
Entry
EF513_03330       CDS       T05750                                 

Definition
(GenBank) hypothetical protein
  KO
K22614  NLR family CARD domain-containing protein 3
Organism
ren  Rickettsiales endosymbiont of Stachyamoeba lipophora
Brite
KEGG Orthology (KO) [BR:ren00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ren04054]
    EF513_03330
Pattern recognition receptors [BR:ren04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   EF513_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_6
Motif
Other DBs
NCBI-ProteinID: AZL15582
UniProt: A0A3Q8T7I3
LinkDB All DBs
Position
complement(724204..726315)
Genome map
AA seq 703 aa AA seqDB search
MAFLMNNTIKVATERGRFKDITFKDIPRDVYSEHILPHLNTGKLYKARSASRFFRQAIGD
YYTKFVRPDHFVKKDTVYCLKDIKMDIIYSIDAMDLDVAQKQQRKNDIMRIWNWLQQQGE
TVSVWQWLRQGVWKLLRQDAIDQEEDLSKIEPICSDEVIISTYYLGTDTSVKIYPLLIKL
YPNLKRSIRVTKGSIELLTKEIQNNVELADSIYAIDCSWQRNKELNANRSNIIALISQLH
HCSNLRTLSLMNNDLGTVDASNFTNLSAALSTLKSLRTLELANNNLSEMDAGKLASLSAA
LSALKNLCTLNLRSNQLGSRNADSLANLAVAIQNCSKLHTLDLSDNQLGSWNADSLANLA
VTLSGLQNLSTFNLRYNKLGARQAGILVGPLQGCPKLHTLDLWGNKLGEEDAEGLSSLAE
ALSGLKNLRSLALGGNKLYEVDGDAFANLMGALSALKNLHTLDLHLNRIDARRALIIIEA
LQDCPKLHTLDLSWNNLVWGRIELGVRRRYVRNYSKEDFTNFAEALLKLKGLHTLELGGN
GISKAQAIITITALSQHTNINSLYFTGIPEDFAKELGRVAGNIPNHPVEIISRDSREQNA
FEQARKAQQLSYREKLQPILNKAKILAAFVIPVVAIAALMYIAGRYIPALNSTFSFVGKA
SGKVTDAARYVVPKCLAEKIENITPKEFLSRIIKTSKTTGIGL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcttttctaatgaataatactatcaaggtggcaactgagagaggacgttttaaagat
ataacatttaaagatataccaagggatgtatattcagaacatattttaccacatcttaat
acaggcaaattatataaagcaaggtcggcaagtcgcttctttcggcaagcaataggcgat
tattataccaaatttgttagaccggaccattttgttaagaaagatacagtctactgcctt
aaagacattaaaatggacatcatttattcaatagatgccatggatcttgatgtagctcaa
aagcaacaaagaaaaaatgatataatgcgcatttggaattggctacaacaacaaggtgaa
actgtaagtgtttggcaatggttgcgccaaggtgtatggaaattgctgcggcaagatgca
attgatcaagaggaagacttatcaaagattgagcccatctgtagtgatgaagtaataatt
tcaacttattatttgggcacagatacgtccgtaaaaatatatcccctgctgataaaatta
tatcctaacttaaagagaagtatccgggttaccaaaggctctatcgagctgttgactaag
gaaattcagaataatgtagaattggctgatagcatatacgctattgactgttcttggcaa
cgcaataaagagttaaatgcaaacagatccaacattattgcattaatctctcaattgcat
cactgtagtaatttgcgcactcttagcttaatgaataatgacctaggaactgtggatgcc
agcaattttaccaacttatccgcagctttatcaaccttaaaaagtttacgtactcttgag
ttagcaaataacaatctaagcgaaatggatgctggtaagcttgccagcttatcagcagct
ctatcagccttaaaaaacttgtgtactcttaatttgcgcagcaaccagctagggagccgg
aacgctgatagcctagccaatttagcagtagctatacagaactgctctaagcttcatact
cttgatttgagcgacaaccagctagggagctggaacgctgatagcctagccaatttagca
gtaactttatcaggcttacaaaacttgagcacttttaatttaaggtataacaagctggga
gcacgccaagctggaatcctagtaggacctctccaaggttgtcctaagcttcatactctt
gatttatggggtaacaagctaggagaggaggatgctgaaggtctatctagcctggcagaa
gctttgtcaggtttaaagaatttgcgtagccttgctttgggtggcaataagctatatgaa
gttgatggcgatgcctttgccaatttgatgggagctctatcagccttaaaaaatttgcac
actcttgatttacatttgaatcgtatagacgctagaagagctctaattattatagaggct
ctccaagattgtcctaagcttcatactcttgatttatcctggaacaatttagtatggggg
agaatagaactaggagtgcgtaggaggtatgtacgcaattacagtaaggaggattttacc
aattttgcagaagcgttattaaaattaaaaggattacatactcttgaattaggtgggaat
ggcatctcaaaagcacaagctattataacaataacagccttatctcaacacactaacata
aactctctttattttaccggcattccagaggattttgctaaagagctaggtagagtggcg
ggcaacataccaaatcacccggttgagattatttctagggatagtagggagcagaatgct
tttgagcaagctaggaaggcacaacagttaagctatagagaaaaactgcaaccgatctta
aataaagctaaaattttagctgcttttgtaataccggtggtagcgatagcggccctaatg
tatattgcaggacgttatattccagctttaaacagtacttttagctttgttggtaaagct
agtggtaaagttacggatgcggcaaggtatgttgtaccaaaatgtttagccgaaaaaatt
gaaaatattacacccaaagaatttttaagtagaataataaaaaccagcaaaaccacaggc
ataggtctttag

DBGET integrated database retrieval system