KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH00122Help
Entry
IE4803_CH00122    CDS       T03667                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-(acyl-carrier-protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00061  Fatty acid biosynthesis
rep01100  Metabolic pathways
rep01212  Fatty acid metabolism
Module
rep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IE4803_CH00122 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rep01004]
    IE4803_CH00122 (fabA)
Enzymes [BR:rep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     IE4803_CH00122 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     IE4803_CH00122 (fabA)
Lipid biosynthesis proteins [BR:rep01004]
 Fatty acid synthase
  Component type
   IE4803_CH00122 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJC77389
UniProt: A0A0A8GA74
LinkDB All DBs
Position
128555..129070
Genome map
AA seq 171 aa AA seqDB search
MTTRQSSFSYEELIACAHGKLFGPGNAQLPLPPMLMVHRITEISETGGAFDKGYLRAEYD
VRPDDWYFPCHFEGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRGMALSTGEVKFKGMVRP
QTKLIEYGIDFKRVMRGRLVLGTADGWLKADGETIYQAADLRVGLSKDKTA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccagacagtccagcttctcgtatgaagaactcatcgcttgcgctcatggcaag
cttttcggccccggcaatgcgcagctgccactgccgcccatgctgatggttcaccgcatc
acggaaatttccgaaaccggcggcgccttcgacaagggctatctcagggccgaatacgac
gtacgccccgacgactggtattttccctgccatttcgaaggcaatccgatcatgccgggc
tgcctcggtctcgacggcatgtggcagctgaccggcttcttcctcggctggctcggcgaa
gaaggccgcggcatggcgctttcgacaggcgaagtgaaattcaagggcatggtgcggccg
cagacgaaactgatcgaatacggcatcgacttcaagcgcgtcatgcgcggccgcctcgtg
ctcggcacggcggacggctggctgaaggcggacggcgagaccatataccaggcggccgat
cttcgcgtcggtctgtcgaaagacaagaccgcctga

DBGET integrated database retrieval system