KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH02046Help
Entry
IE4803_CH02046    CDS       T03667                                 

Definition
(GenBank) xylose isomerase domain-containing protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00040  Pentose and glucuronate interconversions
rep00051  Fructose and mannose metabolism
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IE4803_CH02046
   00051 Fructose and mannose metabolism
    IE4803_CH02046
Enzymes [BR:rep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     IE4803_CH02046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AJC79245
UniProt: A0A0A8GCE1
LinkDB All DBs
Position
2032831..2033820
Genome map
AA seq 329 aa AA seqDB search
MSQTRFATRLNSFASGAHLAWPGQSGKPSVLQMAERAARVQGLTDLDLNYPDHVNDNPAE
LARKLGDFGLSINGFAMRYYTNPDFKLGAFTHPEEAVRREAINLTKKGIDAAREAGANLM
TIWLGQDGFDYAFQADYARLWQHEIDGIREVCQHDPDCLISIEYKPNEPRSYSLLPDAAT
TLLAIKEVGAGNLGVTLDFAHVLYADEQPAFAAALIARHSRVLGVHLNDGYAKRDDGLMV
GAVHLLQTIELLRQIRRDGYDGAIYFDTFPDLTGLDPVRECEVNIKTVRRMLRVVDRLEQ
DNRFSSAIDRQDAVSTLAIVQELMLGADH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagacacgttttgccacacgattgaattccttcgcctctggtgcgcacctcgcc
tggcccgggcagtctggaaagccgtccgtcctgcagatggcggagcgtgcggctcgcgtg
caaggattgaccgacctcgacctgaattaccccgatcacgtgaacgacaatccggctgag
ttggcccggaagcttggcgatttcggcctgtcgatcaatggcttcgcgatgcgctactac
accaatccggatttcaaactcggcgccttcacacatccggaggaagcggttcgccgcgaa
gcgatcaatctgacgaagaaaggcatcgacgcagcgcgcgaggccggcgcgaacctgatg
accatctggctcgggcaggatggcttcgattacgctttccaggccgattatgcgaggttg
tggcaacacgaaatcgacggaatccgtgaagtttgtcaacatgacccggattgcctgatc
tccatcgaatacaagccgaacgagccgcgctcctacagcctgctgcctgatgccgcgaca
acgctgctcgcaatcaaggaagtgggggccgggaatctcggcgtgacgcttgatttcgcc
catgtcctctatgccgacgaacaacccgccttcgcggcggccctgatcgcacgtcacagc
cgggttctcggcgtccatctgaatgatggctacgccaagcgcgacgacgggctgatggtc
ggcgccgttcatttgctgcagaccatcgagttgctccgccagattcgccgggatggctat
gacggcgcgatctatttcgacacattccccgatttgaccggtctcgacccggtccgcgaa
tgcgaggtcaacatcaaaaccgtccgacggatgttgagggtcgtcgaccgcctcgagcag
gacaatcgcttttcgagcgcgattgaccgacaggacgccgtttccacgctggccattgta
caggagttgatgctcggcgcggaccactga

DBGET integrated database retrieval system