KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH02313Help
Entry
IE4803_CH02313    CDS       T03667                                 

Gene name
treS-1
Definition
(GenBank) trehalose synthase 1
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00500  Starch and sucrose metabolism
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IE4803_CH02313 (treS-1)
Enzymes [BR:rep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     IE4803_CH02313 (treS-1)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     IE4803_CH02313 (treS-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJC79506
UniProt: A0A0A8GCN3
LinkDB All DBs
Position
2305009..2306670
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQASPGR
DDGYDVSDYYNVDRRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFQDARSDPN
SRYREWYVWSDKKPANADQGMVFPGVQKTTWTYDEKAKAYYFHRFYDHQPDLNTSNLEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRLGDSIV
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQTLFYALATADTRPLKKAMEVTKSRPATA
QWGLFLRNHDELDLGRLTDKQRNAVFAAFGPERDMQLYDRGIRRRLAPMLGGDRRRIEMA
YSLLFSLPGTPVIRYGDEIGMGDDLCLPERNCARTPMQWSTEPEGGFTKSQKPITPVIKD
GPYGFEHINVAVQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSAVDTGDDGVLALRYDWR
GNSVLILHNLHPHPSEVSFDPDVGEQGRKLIDIAEGASSEADDKGCHKVMLDAYGYRWYR
VGGLDYLLRRKDI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgacctctggtacaaaaacgccgtcatctactgcctgtccgtcgagaccttc
atggatgcgaacggtgacggcgtcggcgattttcagggactgatgcgccgtctcgactat
ctctccggcctcggcgtgacagcgatctggctgatgccgtttcaggcgtctcccggtcgt
gacgacggttacgacgtctccgactattacaatgtcgaccggcgctacggttcgctcggc
gatttcgtcgaattcacccacggcgccaagcagcgcggcatccgggtgctgatcgatctg
gtgatcaatcacacctcgaaggatcatccctggtttcaggacgccagaagcgatccgaat
tcgcgctatcgtgaatggtacgtctggtcggacaaaaagcctgcgaatgcggatcagggc
atggttttccctggcgtccagaagaccacctggacctatgacgaaaaagccaaggcctat
tatttccaccgcttctacgatcaccagcccgatctgaatacatcaaacctggaagtgcag
gccgagatcctcaagatcatggggttttggatccagctcggtgtttcgggcttccgcatg
gacgccgcccccttcatcattgccacgaagggggccgaggtcaccaagccggtcgagcag
ttcgacatgctgaggaagtttcgcgagttcctgcaatggcgcctgggcgactccatcgtg
ctggcggaggccaacatcctgccgaaggataatttcgaatatttcggcgacgatggcgac
cgcatgcagatgatgttcaatttccaggtcaaccagacgctgttctatgcactcgcgacg
gccgatacccgcccgctgaagaaggcgatggaggtcaccaagtcgcgcccggcaactgcc
caatgggggctgtttcttcgcaaccacgatgaattggatctcggtcgtctgacggataag
cagcgcaacgcagtatttgccgcgttcggacccgagagggacatgcagctttatgacaga
ggcattcgacgtcgcctggcgcccatgcttggcggcgaccggcgcaggatcgagatggcc
tacagcctgctattctcgctgcccggaactccagtcatccgctacggcgatgaaatcggc
atgggcgatgatttgtgcctgccggagcgcaactgcgcgcgcaccccgatgcaatggtcg
acggagccggaaggcggcttcaccaaaagccaaaaacccattacgccggtcatcaaggac
ggcccctacggcttcgaacatatcaacgtcgccgtccagcggcgcgacccgaactcgctc
ctgaactggaccgagcgaatgatccgaatgcgcaaggaggctcccgaaatcggttggggc
gatttctcggcggtcgacacaggcgacgacggcgtactggcgctgcggtatgactggcgc
ggcaattcggtgctgatcctgcacaacctgcatccgcacccgtcggaagtaagtttcgat
cccgatgtcggtgaacaggggcgaaagttgattgatattgccgagggtgcgagcagcgag
gcggacgacaaagggtgccataaggtcatgctcgatgcctatggctatcgttggtatcgc
gtcggcggtctcgactatctcctcaggcggaaggacatttag

DBGET integrated database retrieval system