KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH02527Help
Entry
IE4803_CH02527    CDS       T03667                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00061  Fatty acid biosynthesis
rep00780  Biotin metabolism
rep01100  Metabolic pathways
rep01212  Fatty acid metabolism
Module
rep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IE4803_CH02527
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IE4803_CH02527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rep01004]
    IE4803_CH02527
Enzymes [BR:rep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     IE4803_CH02527
Lipid biosynthesis proteins [BR:rep01004]
 Fatty acid synthase
  Component type
   IE4803_CH02527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AJC79716
UniProt: A0A0A8GD39
LinkDB All DBs
Position
complement(2518482..2518964)
Genome map
AA seq 160 aa AA seqDB search
MLLEYFQMIDRVEAVDLKKGTLTARSVVPAKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAATDFAAMPFLMSVDGAKMRTFVEPEAVLDIEAVLEHDGSGFAVTKAKITSGGKKVC
DAQLKLRTMPFSEVPLGDIVKKRASEVGLLEAIAAQGVIG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaatatttccagatgattgaccgcgtcgaagcggtagacctgaagaagggc
acgcttacggcgcgatccgtcgtgccggccaagagccccgtcttcgagggccattttccc
ggcatgccgctcgttcccggcgtgttgctgatcgagaccatggcgcaggcctccggtatg
ctggtgcttgccgccaccgattttgccgccatgcccttcctgatgtcggtcgacggcgcc
aagatgcgcaccttcgtcgagccggaagccgtgctcgacatcgaggcggtgctggagcac
gacggttcgggcttcgcggtcaccaaggccaagatcaccagcggcggcaagaaggtctgc
gacgcgcagctgaaactgcgcaccatgcccttcagcgaggtgccgctcggcgatatcgtg
aaaaaacgcgccagcgaggtcgggcttctcgaagcgatcgcagcgcagggagtgattgga
tga

DBGET integrated database retrieval system