KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH03194Help
Entry
IE4803_CH03194    CDS       T03667                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase GroES-like protein
Organism
rep  Rhizobium etli bv. phaseoli IE4803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJC80368
UniProt: A0A0A8GEH4
LinkDB All DBs
Position
3208524..3209552
Genome map
AA seq 342 aa AA seqDB search
MKAVRLQAIGQLQLCEIEKPAPGPGELLVRVEACGICGTDRHIFHGEFPSKAPVTLGHEF
AGIIETIGPGVTGFRPGMRVTGDPNISCGGCEECRRGRVNLCRNLRAIGIHRDGGFAEYV
CMPQTQAFALPAALDPLHGAFCEPLACCIHGVDLAGLKTGSSAIVLGGGVIGLLTLQLAR
LAGATRILLVTRSAEKRRLAESLGATTTVDPGDGDLIARITAENGLLPGGADVVFECAGV
AETMQQAPQLARRGGTAVILGVMPQGATIEIEPFDLLFREVALISSFVNPFTHARAADLV
ASGRIKVEPLISRRIGLEEAPEAITNPARGGEIRVLVVPGGK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcgtctgcaagcaattggacagttgcaactctgcgaaatcgaaaaaccc
gcacccggccccggtgaattgctggtccgcgtcgaagcctgcggcatttgcggcaccgac
cgtcacatctttcacggtgaattcccatcgaaggcgccggtgacgctcggacatgaattc
gccgggatcatcgagacgatcgggccaggcgtgactggtttccgccccggcatgcgcgtg
accggcgatccgaacatatcttgcggcggctgcgaggaatgccggcgcggccgcgtcaat
ctctgccggaacttgcgggcgatcggtattcaccgcgacggcggcttcgccgaatatgtc
tgcatgcctcaaacccaggctttcgcgctgccggccgctctcgatccgctccacggcgcc
ttctgcgagccgctggcctgctgcatccacggcgtcgatctcgccgggctgaaaaccggc
tcgtcggccatcgtgctcggcggtggcgtcatcggcctgctcacacttcaactggcgcgg
cttgccggtgcgacccgtatcttgctggtgacccgcagcgccgaaaagcggcggctggcc
gaaagcctcggcgccactaccacagtcgatcccggggatggcgatctcattgcccgcatc
accgctgagaacggactgctgcccggcggcgccgatgtcgtcttcgaatgcgccggcgtg
gcagagaccatgcagcaggcgcctcagcttgcccggcgcggcggcaccgccgtcattctc
ggcgtcatgccgcagggtgccacgatcgagatcgagcccttcgacctgctgtttcgcgaa
gtcgcgctgataagctccttcgtcaaccccttcacccatgcccgcgccgccgatctcgtc
gcctctggcaggatcaaggtcgagccgttgatatccaggcggatcgggctcgaggaggcc
ccggaagcgatcaccaatccggcgcgcggcggcgaaatccgcgtccttgtcgtacccggc
ggtaaatag

DBGET integrated database retrieval system