KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH03305Help
Entry
IE4803_CH03305    CDS       T03667                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00240  Pyrimidine metabolism
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IE4803_CH03305 (tdk)
Enzymes [BR:rep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IE4803_CH03305 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AJC80476
UniProt: A0A0A8GFD2
LinkDB All DBs
Position
complement(3324057..3324659)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFKLIAGLCGDGAPISCVFVDEAHFMTAVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAHGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactattcgacgatgaacgccggcaagtcgacgctgctgctg
caggcctcctacaattatcaggagcgcggcatgcgtacggtgcagctgattgcggccttc
gacgagcgcgccggccggggcgtcatcggctcgaggatcgggctggaagcgagcgccatc
cccttcgagccgcacgaagatctgttcaagctcatcgccggactgtgcggcgacggggcg
ccgatttcctgcgtcttcgtcgacgaggcgcatttcatgacggccgtccatgtctggcag
cttgcccgtgtcgtcgatcggctcggcatccctgtcatggtctatgggctccggaccgac
ttccagggcaaactgtttccggcttcgcaggagttgctggcgatcgctgacgagatgcgc
gaagtgcgcacgatctgccattgcggccgtaaggcgacgatggttgtgcggctcgacgcc
cacggcaaggtgctgcacgagggcgcgcagatcgatgtcggcggtaacgagaaatatgtc
tcgctctgccgcaggcactgggacgacgaaatgaacggcgcctggatcgcggagccggtc
tga

DBGET integrated database retrieval system