KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_CH04272Help
Entry
IE4803_CH04272    CDS       T03667                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00020  Citrate cycle (TCA cycle)
rep00310  Lysine degradation
rep00380  Tryptophan metabolism
rep01100  Metabolic pathways
rep01110  Biosynthesis of secondary metabolites
rep01120  Microbial metabolism in diverse environments
rep01130  Biosynthesis of antibiotics
rep01200  Carbon metabolism
Module
rep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IE4803_CH04272 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    IE4803_CH04272 (sucA)
   00380 Tryptophan metabolism
    IE4803_CH04272 (sucA)
Enzymes [BR:rep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     IE4803_CH04272 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJC81409
UniProt: A0A0A8GLA4
LinkDB All DBs
Position
complement(4334355..4337339)
Genome map
AA seq 994 aa AA seqDB search
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPASVDDQWRAFFKALEEDPADVKKAA
KGASWRKKHWPLAAGGDLVSALDGNWGIVEKAIETKVKAKAEAAGKPADTTDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAATVDDYHELSPENYGFTSADYDRKIFIDNVLGLE
YATIREMIEILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGVAFSAEGKKAILAKL
IEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKRGGHLGLKEAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFDGNKVHVSLTANPSHLE
IVDPVVMGKVRAKQDMSATVWDGDIIPLSERAKVLPLLIHGDAAFAGQGVIAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPILHVNGDDPEAVVYAAKI
ATEFRMKFHKPVVVDMFCYRRYGHNEGDEPSFTQPKMYKVIRGHKTVLQLYADRLVREGL
LTDGEVEKMKADWRAHLEQEFEAGQSYKPNKADWLDGEWSGLRTADNADEQRRGKTAVPM
KTLKEIGRKLSEIPAGFNAHRTIQRFMENRANMIATGEGIDWAMAEALSFGALCLEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AEMAGESAFHRLLWDDAEVIKDGPIKLQKDNKIRRVVMCSGKVYYDLLEEREKRGIDDIY
LLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPFLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagaagccaacgagcagtttcagatcacctcgtttctggatggcgccaac
gcggcctatatcgagcagctctatgcgcgctacgaagaggatccggcatcggtcgacgat
caatggcgcgccttcttcaaggcgctggaagaggatcctgctgatgtgaagaaggcggcc
aagggagcctcctggcgcaagaagcactggccgctggccgccggcggcgatttggtgtcg
gcgctcgacggcaattggggcatcgtcgagaaggcgatcgaaaccaaggtgaaggcaaag
gccgaagccgccggcaagccggccgacaccaccgacgtgctgcaggcgacgcgcgattcg
gtgcgcgccatcatgatgatccgcgcctatcgcatgcgcggccatctgcacgccaagctc
gatccactcggcatcgccgctaccgtcgacgactatcatgagctgtcgccggaaaattac
ggcttcacatcagccgattatgatcgcaagatcttcatcgacaacgtgctcggcctggaa
tacgcgaccatccgcgagatgatcgagatcctcgagcgcacctactgctcgacgctcggc
gtcgaattcatgcatatctccaatccggaggagaaggcctggatccaggagcggatcgaa
gggccagacaagggcgtcgccttctcggcggaaggcaagaaggcgatccttgccaagctc
atcgaagccgagggttacgagcagttcctcgacgtcaagttcaagggcaccaagcgtttc
ggtctcgacggcggtgaatcgctgatccccgcactggaacagatcctgaagcgcggcggc
catctcggccttaaggaagcggtattcggcatggcccatcgcggccgtctgaacgtgctc
tcccaggtgatgggcaagccgcaccgcgccatcttccacgagttcaagggcggttcctat
gcgcctgacgaagtcgaaggttccggcgacgtgaagtaccatctgggcgcttcctccgac
cgcgaattcgacggcaacaaggtgcacgtctcactgacggcaaatccgtcgcatcttgaa
atcgtcgatcctgtcgtcatgggcaaggttcgcgccaagcaggacatgagcgctacggta
tgggacggcgacatcattccgctgtctgaacgcgccaaggtgctgccgttgctgatccac
ggcgacgcggccttcgccggccagggcgtcattgccgaaattctcggcctctccggtctg
cgcggccaccgtgtcgccggcaccatgcacgtcatcatcaacaaccagatcggcttcacc
acgaacccggccttttcgcgctcgtcgccctatccgtctgacgtcgccaagatgatcgag
gcgccgatcctgcacgtcaacggcgacgatccggaagccgtggtctacgccgccaagatt
gcgaccgaattccgcatgaagttccacaagccggttgtggtcgacatgttctgctatcgc
cgctacggtcataacgaaggcgatgaaccgtcctttacccagccgaagatgtacaaggtc
atccgcggccacaagacggtgctgcagctttatgcagatcgtctcgttcgcgaaggcctg
ctcacggatggcgaagtcgaaaagatgaaggccgactggcgcgcgcatctcgagcaggag
ttcgaggccggccagagctacaagccgaacaaggccgactggctggacggcgagtggtcg
ggcctgcgcaccgccgacaatgccgacgagcagcgccgcggtaagaccgccgtgccgatg
aagacgctgaaggagatcggccgcaagctctcggagatcccggcaggcttcaatgcgcac
cgcacgattcagcgcttcatggaaaaccgggccaacatgatcgccaccggcgagggcatc
gactgggcgatggcagaagcgctctccttcggggcgctctgcctggaaggccacaagatc
cgcctgtccggccaggattgcgagcgcggcaccttctcgcagcgccactcggttctctac
gatcaggagaccgaggagcgttacattccgctcgccaatctttcgccgacgcaggcgcgc
tacgaagtcatcaactcgatgctttcggaagaggccgtgctcggcttcgaatacggctat
tcgctcgcccgcccgaatgcgttgacgctctgggaggcgcaattcggcgatttcgccaac
ggcgcgcaggtggtcttcgaccagttcatctcctcgggcgaacgcaagtggctgcgcatg
tcgggcctcgtctgcctgttgccgcacggctatgagggccaaggtccggagcattcctcg
gctcgcctcgagcgcttcctgcagctctgcgcggaagacaatatgcaggtcgccaatgtc
acgacgccggcgaactatttccacatcctgcgccggcagctgaagcgcgacttccgcaag
ccgctgatcctgatgacgccgaaatcgctgctgcgccacaagcgggcggtctcgacgctg
gccgaaatggccggtgaatccgccttccatcgcctgctctgggacgatgccgaggtgatc
aaggacggcccgatcaagctgcagaaggacaacaagatccgtcgagtcgtcatgtgctcc
ggcaaggtctactacgatcttctcgaagagcgtgaaaagcgcggtatcgacgacatctac
ctgctgcgcgtcgaacagctttatccgttcccggcaaaggcgctcatcaacgagctgtcg
cgcttccgcaacgccgaaatggtctggtgccaggaagagccgaaaaacatgggcgcatgg
tcgttcatcgatcctttcctcgaatgggtgcttgcccatatcgatgcgaaataccagcgt
gtccgttacaccggccgtccggctgccgcctcgccggcgacgggcctgatgtcgaagcat
ctgtcacagctcgccgcattcctcgaggatgcattgggcggttaa

DBGET integrated database retrieval system