KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PA00166Help
Entry
IE4803_PA00166    CDS       T03667                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IE4803_PA00166
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rep02000]
    IE4803_PA00166
Enzymes [BR:rep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IE4803_PA00166
Transporters [BR:rep02000]
 Other Transporters
  Pores ion channels [TC:1]
   IE4803_PA00166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJC81810
UniProt: A0A0A8GJS2
LinkDB All DBs
Position
pRetIE4803a:complement(186362..187087)
Genome map
AA seq 241 aa AA seqDB search
MAYELYYWDGIQGRGEFVRLALEEAGADYVDITREPGRGSGAMFDIMQSESEAHIPFAPP
FLKDCDLIIPHVANILFYLGPRLGLAPGNEGLRHVANGLQLTITDFIAEVHDTHHPIDMS
RYYEEQKQEAKARSAAFIGQRIPKYLGYFERVLRQNPDGSGHIVGDALTYVDLSLFQVIE
GLTYAFPKAMDKRKADYPALLTLHAAVAKRPNIARYLASPRRLPFNEEGIFRHYPELDST
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatgagctttattattgggacggcatccagggtcgcggtgaattcgtccggctt
gcgctggaggaagccggcgccgactacgtcgacatcacccgtgagcccggccgcggcagc
ggcgccatgttcgacatcatgcaaagcgaaagcgaagcgcatattcccttcgcgccgccc
ttcctgaaggattgcgatctgattatcccgcatgtcgccaacatcctgttttatctcggc
ccgagactggggcttgcccccgggaatgagggccttcgtcatgtcgccaacggcctgcag
ctcaccattaccgatttcatcgccgaggtgcacgacacgcatcacccgatcgacatgtca
cgatattacgaagagcagaagcaggaggcgaaggcccgctcggcagcctttatcggccag
cgcattccgaagtaccttggctatttcgagcgtgtgctgcggcaaaaccctgatggttcc
ggccatatcgtcggcgacgcgctgacctatgtcgacctttcgcttttccaggtgatagag
ggcctgacctatgcctttccgaaggccatggacaaacgcaaggccgattaccccgccctt
ttgaccctgcatgccgcggtggcaaaacggccgaacatcgcccgctatcttgcctcccct
cgccgcctgcccttcaatgaggagggtattttcaggcattatcccgagctcgacagcacg
gaatga

DBGET integrated database retrieval system