KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PC00492Help
Entry
IE4803_PC00492    CDS       T03667                                 

Definition
(GenBank) glycosyde hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00500  Starch and sucrose metabolism
rep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IE4803_PC00492
Enzymes [BR:rep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     IE4803_PC00492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AJC83038
UniProt: A0A0A8GMF9
LinkDB All DBs
Position
pRetIE4803c:511564..512991
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGADPAHIGVNAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PTSPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPVPGGVLPS
LVDYVNFAALCQANAKNSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLDG
ATQTIAKQLVQANLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGIAVP
AGVSDAISWLETQLVTHWNGQLYVSILDAAEQAGYDANIDIVSSVCYGGIEPCDTKLLAT
AAILRRQWADPSSSTYYPVNGADAANGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANAIDASGAIPLDQFSEPFFAGLGLGASSSAADASAALRASSDAMLRAIVYH
SDHYELSEQFDGTVGYEKSVRNLSWSYASFLSAVRARAAAPAAKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcggacccggcccatatcggcgtc
aatgcgcctacggtcaagccgaggcctgccttcgcgcagaccgatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
cccacatcgcccggcgtcttttcggccccgggctgcgtcatcgccgcaccctcctatccg
gcgaacacgccgggtgtggaccaggactatgttttcaactgggtccgcgacggggccatt
acggccatcgagatcgcgcttgccggcttgctgcccgttccgggcggagttttgccgagc
ctggtcgactacgtgaacttcgccgcgctctgccaggcgaatgcgaagaattccgacacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgacgggccggcaattcagtcgattgcgatcctgaccctgttcgatcagctggatggc
gccacacagacaatcgccaaacaactggtccaggccaacctcgcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatatgagggctattcgtttttcgcaaga
gccgtacagttgcgctttttccgcgaaatttccacaaacacgatcggcattgcggtgcct
gccggggtgtcggatgccatctcctggctggaaacccagctggtaacccactggaacggg
caactctatgtgagcattctggatgccgcggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccatgcgataccaagcttctggcaacg
gcggccatcctgcggcgccagtgggccgatccttcgtcttcgacctattacccggtcaat
ggcgccgacgcggccaacgggctcggaccactcttcgggcgctatccgggcgaccattac
gatggcgatgtggcagctccggttgccggcgggcatccctgggctctgtgcaccgccaac
ttcgccgagtttcaatatcggcttgccaatgccatcgatgccagcggcgccatccccctc
gatcagttctccgaacccttcttcgcgggactgggacttggcgcatccagcagcgccgcc
gacgcgtcggctgccttgcgggcctcgtctgacgccatgctgcgcgccattgtctatcac
agcgatcactatgagctgagcgaacagttcgatggaaccgttggctacgagaaaagcgtc
cggaatctgagctggagctatgcctccttcctctcggcagtcagagcccgcgccgccgcg
ccggccgccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system