KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PD00328Help
Entry
IE4803_PD00328    CDS       T03667                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00564  Glycerophospholipid metabolism
rep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IE4803_PD00328 (glpD)
Enzymes [BR:rep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IE4803_PD00328 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJC83527
UniProt: A0A0A8GPI0
LinkDB All DBs
Position
pRetIE4803d:364467..365981
Genome map
AA seq 504 aa AA seqDB search
MGREIHDIFVIGGGINGCGIARDAVGRGYTVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRKDPAGKPLKALFTRAFEYSDGWVDDARMVVLNARDAADKGATILPRTKVVS
ARRESGLWHIETVDTVTGRKDGHQARMLVNAAGPWVDHVIRSAFGQKEAHNVRLVQGSHI
VVKKKFDDPRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPKDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLDGERETAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGNFAVKGYEAEVAKLKGRYPFLADRH
ARRLVRRYGTRAETLLGNARGIDDLGRLFGGDLYEAEVAYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatacacgacattttcgtcattggcggcggcatcaacggctgcggcatc
gctcgcgatgctgtcgggcgcggctataccgtggcgctggcggagatgaacgatttcgct
tcgggcacctcatctggcgccaccaagctgatccatggcggcctgcgttatctcgagcat
tacgagttccgcctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcatattatctggccgctgcgtttcgtgctgccttatcataagggcggcatccgccca
gcttggctgatccggctcggcctcttcctctacgaccatcttggcggccgcaagctgctg
ccggcgacgtcggtgcttgacatgcgcaaggatccggccggcaagccgctgaaggcattg
tttacgagagcgttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgatgctgccgacaagggtgcgaccatcctgccgcgtaccaaagtggtctcg
gcaaggcgtgagagcggcctatggcacatcgagactgtcgataccgtcaccggccgcaaa
gacggtcatcaggcccgcatgttggtcaatgccgccggtccctgggtcgatcacgtcatt
cgttccgccttcggtcagaaagaagcccacaatgtccgcctcgtccagggcagccatatc
gtcgtcaagaagaagttcgacgatccacgcgcctatttcttccagaatccggacaatcgc
atcatcttcgccattccctatgagggcgacttcaccctgatcggcacgaccgaccgcgac
tataccgccgatcccaaggatgtcaggatctccgaggaggagacggtctatctctgcaat
gcggcgtcggaatatttcaaggagccggtgcggccagaggatatcgtctggacctattcg
gcggtgcgcccgctttatgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagctcgacggcgagagggagaccgcgccgctgcttaatgttttcggcggcaag
ctcaccacttatcgccggctgtccgagcatgcgttggagaagatcggtgctgcgatcggc
gtcaagggtgctccgtggacggccaagagccatctgcccggcggcaatttcgccgtcaag
ggttatgaggccgaggttgccaagctgaaaggccgctatccgttcctcgccgatcggcac
gctcgccggctggtgcgtcgctacggcaccagggccgagacgctactcggcaatgcccgt
ggcattgacgatctcgggcggctgttcggcggcgatctctacgaggccgaggtcgcctat
ctcgtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggagcaggctcagtcactggaggagtacatggctgccatgccg
gcgatggccggatag

DBGET integrated database retrieval system