KEGG   Rhodococcus hoagii: REQ_07490Help
Entry
REQ_07490         CDS       T01352                                 

Gene name
mce2E
Definition
(GenBank) putative Mce family lipoprotein Mce2E
  KO
K02067  phospholipid/cholesterol/gamma-HCH transport system substrate-binding protein
Organism
req  Rhodococcus hoagii
Pathway
req02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:req00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    REQ_07490 (mce2E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:req02000]
    REQ_07490 (mce2E)
Transporters [BR:req02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   gamma-Hexachlorocyclohexane transporter
    REQ_07490 (mce2E)
   Phospholipid transporter
    REQ_07490 (mce2E)
   Mce system transporter
    REQ_07490 (mce2E)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD Mce4_CUP1 Baculo_PEP_C EzrA DUF948
Motif
Other DBs
NCBI-ProteinID: CBH46865
UniProt: A0A3S5Y2V5
LinkDB All DBs
Position
774732..775967
Genome map
AA seq 411 aa AA seqDB search
MNTFSTARRAGLTASLLAATLVLSGCEWSGLNSVPLPGTQGRGDGAYEVEIQMPNVTTLT
QNSPVRVGDVTVGSVSKIEVQGWHALVTASLNGDVDLPANSTAKIGQTSLLGSAHLELAP
PAGEAPKGKLADGDVIPLERAGVYPTTEQTLSSLSVVLNGGGLAQLQDITSELNKALDGR
EDSVRDLLPQLDTLVGSLDRQRNEIVSAMEGINRLAGTAAKQTDTISKALDEIPPALEVL
VDQRQDITNALVSLGQLSDVANRLIEKSGDDFATNVRALVPTLAALANSGENLTGVLGVL
LTFPFPQAGLNNVIRGDYTNLAMTIDLTAPRLERNFLFRTPMAGRLGGPEGILATAAGVA
GQAQDPLRGPLQPPAEPAESEAPDAPGAGGIQIPGLPPINIPGLPLGEPAP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgttctctaccgcacgccgggccggtctcacggcgagcttgctcgccgcgacg
ctcgttctgtccggatgtgagtggtcgggcctcaactcggtgccgttgcccggaacacaa
ggccgcggcgacggcgcttacgaggtcgagatccagatgccgaacgtgactacgctgacc
cagaattcgccggtccgtgtgggcgacgtgacggttggcagcgtctcgaagatcgaggtc
cagggctggcacgcgctggtcaccgcgtctctcaacggggacgtcgatcttccggcgaac
tcgaccgcgaagatcggccagaccagcctgctcggctcggctcatctggagttggctccc
cctgccggggaggcgccgaagggcaagcttgccgacggcgacgtgatcccgctcgagcgc
gcgggtgtgtacccgaccacagagcagaccttgtcgtctctgtccgtggtgctcaatggt
ggtgggctggcgcagctgcaggacatcacgtcggaactgaacaaggcactggacggtcgt
gaggattcagtgcgagacctgttgccgcagttggataccttggtcggcagtctcgaccgc
cagcgcaacgagatagtgtcggcgatggaggggatcaaccgtctggcgggtaccgcagca
aagcagaccgacaccatctcgaaagcgctggacgagatcccgccggcgctcgaggtactg
gtcgatcagcggcaggacatcacgaacgcattggtgtcgctcggccagctcagcgacgtc
gcgaaccgtctgatcgagaagagcggcgacgacttcgcgacgaatgtccgcgcactcgtc
ccgacactggctgcgctcgccaactccggggagaatttgaccggggttctcggagttctg
ctgaccttcccgttcccgcaggccggactcaacaacgtcatccgtggtgactacacgaat
ctcgcgatgaccatcgatctaacggccccgcgtctcgagcggaactttttgttccgaacc
ccgatggcgggccgtctcggcggtcccgagggcattctcgccaccgccgcgggtgtcgcc
ggacaggcgcaggacccgctccgcgggccgctgcaaccgcctgccgaacccgccgaatcc
gaggcgccggatgcgcctggggcgggcggaattcagattccgggcttgcctccgatcaac
attccaggtctaccgttgggggagccggcaccatga

DBGET integrated database retrieval system