KEGG   Rhodococcus hoagii: REQ_23410Help
Entry
REQ_23410         CDS       T01352                                 

Definition
(GenBank) putative secreted protein
Organism
req  Rhodococcus hoagii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAP
Motif
Other DBs
NCBI-ProteinID: CBH48387
UniProt: A0A3S5Y774
LinkDB All DBs
Position
complement(2467787..2468254)
Genome map
AA seq 155 aa AA seqDB search
MTDRRTTRCIIRSVAVAGAALAAVAVPATAQALPPHPFGPPAMTIGCANQGSLMSLTGAT
GQTGPEQNPPIGPGEIRFESFPAAPPIPAAGQVTVAWVNLDTGASGMAALEGAYPYYSKT
VYTGHGNIRATVFGTIDLWSLPLCQSNPTFGNFIV
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgacgaacaacccgatgcatcatccgatctgtggcggtcgcaggcgctgct
ctggcggctgtcgcggttcctgcgacagctcaggcattgccaccgcatccgttcggcccg
ccggccatgaccatcggctgcgccaaccagggcagcctgatgtcgctcaccggcgccacg
ggacagaccgggcccgagcagaatccgccgatcggaccgggtgagatccggttcgagtcg
ttcccggcggcgcccccgatccccgccgccggtcaggtcaccgtcgcgtgggtcaacctc
gacacgggcgcgagcggtatggcggctctcgagggcgcctacccgtactactcgaagacc
gtctacaccggtcacggcaacatccgggccaccgtcttcggcacgatcgatctgtggagc
ctgccgctgtgtcagtcgaatccgacgttcggcaacttcatcgtctga

DBGET integrated database retrieval system