KEGG   Rhodococcus hoagii: REQ_27230Help
Entry
REQ_27230         CDS       T01352                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
req  Rhodococcus hoagii
Brite
KEGG Orthology (KO) [BR:req00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    REQ_27230
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     REQ_27230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C K_oxygenase DAO FAD_binding_3 Glutaredoxin FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CBH48743
UniProt: A0A3S5Y8B9
LinkDB All DBs
Position
2882848..2884437
Genome map
AA seq 529 aa AA seqDB search
MLDAPLAAQLKSLLERLTLPIELVSSLDDGAKSAELAELLTEIAAMSDKITYERLDDDAR
RPSFAIRRVGTDIEVRFAGIPLGHEFTSLALALLQVGGYPSKEAPEVLEQVQGLEGKYHF
ETYFSLSCQNCPDVVQALNLMAVLNPGVSHVAIDGALYQDEVDGRQIMAVPTVYLNGELF
GSGRMSLAEIVNKLDDGAADRAAAAIAEKDPFDVLVVGGGPAGAAAAIYAARKGIRTGIA
AERFGGQVLDTMAIENYISVPYTEGPKFGAALENHVRQYDVDLMNTQRAAKLVPAATENG
LVEVELESGASLLARTVILSTGARWRSMNVPGETEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLVEFDSVLRADEVLQRKLRSLPNVTILLSTLTTEVLGDG
SKVTGLTYTDRTTDESHTVDLEGVFVQIGLLPNTEWLDGSVDLSPRGEIVVDDRGQTSVP
GVFAAGDCTTVPFKQIVIAAGAGATAALSAFDHLIRTSAPEEESAAAVG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcccccctcgccgcccaactgaagtccctcctcgagcggttgaccctgccg
atcgagctcgtgtcctccctcgacgacggagccaagtcggccgaactcgccgaactgctc
accgagatcgccgcgatgtcggacaagatcacctatgagcgtctcgacgacgacgcccgg
cgcccgtcgttcgccatccgccgcgtcggcaccgacatcgaggtccgcttcgccggcatc
cccctcggtcacgaattcacctcgctcgcactcgcattgctccaggtcggcggctacccg
tcgaaggaagcccccgaggtgctcgagcaggtccagggactcgaaggcaagtaccacttc
gagacctacttctcgctgtcctgccagaactgccccgacgtcgtccaggcactgaacctg
atggccgtgctcaaccccggtgtcagccacgtcgcgatcgatggtgcgctctaccaggac
gaggtcgacggccggcagatcatggcggtgcccaccgtgtacctcaacggtgaactcttc
ggctccggtcggatgagcctcgccgagatcgtcaacaagctcgacgacggcgccgccgat
cgcgcggcagccgcgatcgcggagaaggacccgttcgacgtgctcgtcgtgggtggcggc
ccggccggagctgcggccgcgatctacgctgcccgcaaggggattcgcaccggcatcgcc
gccgagcgcttcggcggtcaggtcctcgacacgatggcgatcgagaactacatctcggtc
ccctacaccgagggcccgaagttcggcgctgcactcgagaaccacgtgcgccagtacgac
gtcgacctcatgaacacccagcgtgccgcgaagctcgtgccggcggccaccgagaacggc
ctcgtcgaggtcgaactggagagcggcgcttcgcttctcgcccgcacggtgatcctgtcg
acaggtgcgcgctggcgctcgatgaacgtgcccggcgagaccgagtaccggaacaagggc
gtcacctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtcgcggtcatc
ggcggcggcaactcgggtgtcgaggcggccatcgacctcgcgggcatcgtctcgcacgtc
acgctcgtcgagttcgactcggtgctgcgcgccgacgaggtgctgcagcgcaagctgcgc
agcctgccgaacgtgaccatcctgctcagcaccctcaccaccgaggttctcggcgacggc
agcaaggtcaccggcctcacctacaccgaccgcaccaccgacgagtcgcacaccgtcgac
ctcgagggcgtgttcgtgcagatcggcctgctccccaacaccgagtggctggacggcagc
gtcgacctgtcgccgcgcggagagatcgtcgtcgacgaccgcggtcagacgtcggtgccg
ggcgtgttcgccgcgggtgactgcacgacggttccgttcaagcagatcgtgatcgctgcc
ggagcaggagcgacggctgccctgtccgcgttcgatcacctgatccgcaccagcgctccg
gaagaggagtcggcggcagcggtcggctga

DBGET integrated database retrieval system