KEGG   Rhodococcus hoagii: REQ_34420Help
Entry
REQ_34420         CDS       T01352                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
req  Rhodococcus hoagii
Pathway
req00020  Citrate cycle (TCA cycle)
req00480  Glutathione metabolism
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01200  Carbon metabolism
req01210  2-Oxocarboxylic acid metabolism
req01230  Biosynthesis of amino acids
Module
req_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REQ_34420
  Metabolism of other amino acids
   00480 Glutathione metabolism
    REQ_34420
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     REQ_34420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CBH49437
UniProt: E4WKH8
LinkDB All DBs
Position
complement(3653203..3654420)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGKVVELDGDEMTRIIWQFIKDKLIHPYLDVDLEYYDLGIEHRDATDDQVTIDA
AEAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPILISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKAPGAGTVTITYTPDDGSEPIQHEVCRLPEDGGVVM
GMYNYKKSIQDFARASLSYGLQQNYPVYLSTKNTILKAYDGMFKDEFQRIYEDEFKAEFD
AAGLHYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPELIEFAQQLE
DVVIKTVENGQMTKDLALLVGPDQAWQTTEEFLATLDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggtcgaaggcaaggtcgtcgaactcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaagacaagctgatccatccctacctggatgtcgatctcgag
tactacgacctggggatcgagcatcgcgatgccaccgacgaccaggtcaccatcgacgcc
gccgaagcgatcaagaagcacggcgtcggcgtcaagtgcgccacgatcaccccggacgag
gcgcgggtcgaggaattcggcctgaagaagatgtggcgttccccgaacggcaccatccgt
aacatcctgggcggcacgatcttccgcgcccccatcctgatctcgaacgtcccgcgtctg
gtccccgggtggaccaagccggtgatcgtcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaggcacccggcgccggcaccgtcaccatcacctacactccggacgac
ggctccgagccgatccagcacgaggtgtgccgcctgcccgaggacggcggcgtggtcatg
ggtatgtacaactacaagaagtccatccaggacttcgcgcgggcctcgctgtcctacggc
ctgcagcagaactacccggtgtacctctccaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgagttccagcggatctacgaggacgagttcaaggccgagttcgac
gccgccggcctgcactacgagcaccgtctcatcgacgacatggtcgcctcgtccctcaag
tgggagggtggctacgtctgggcctgcaagaactacgacggtgacgtccagtccgacacc
gttgcgcagggctacggctcgctgggtctgatgacctccgtgctgatgaccccggacggc
cgtaccgtcgaggcggaggccgcacacggcaccgtcacgcgccactaccgtcagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcgtggacccggggcctc
gagcaccgcggcaagctggacaacaccccggagctgatcgagttcgcacagcagctcgag
gacgtcgtcatcaagaccgtcgagaacggtcagatgaccaaggacctcgcactgctggtc
ggcccggaccaggcctggcagaccaccgaggagttcctcgcgaccctcgacgagaacctg
cagaaggcgcgcgcgtaa

DBGET integrated database retrieval system