KEGG   Rhodococcus hoagii: REQ_35320Help
Entry
REQ_35320         CDS       T01352                                 

Gene name
alr
Definition
(GenBank) putative secreted alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
req  Rhodococcus hoagii
Pathway
req00473  D-Alanine metabolism
req01100  Metabolic pathways
req01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    REQ_35320 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    REQ_35320 (alr)
Enzymes [BR:req01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     REQ_35320 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:req01011]
 Precursor biosynthesis
  Racemase
   REQ_35320 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TALPID3
Motif
Other DBs
NCBI-ProteinID: CBH49521
UniProt: E4WKR2
LinkDB All DBs
Position
complement(3748449..3749693)
Genome map
AA seq 414 aa AA seqDB search
MAGSKFVTTTAQEPDTAPTQTSAPVAANTPPSAAAPQAEAVIDLDAVAYNIGILREHAGG
ATVMAVVKADAYNHGAVPVARAALAAGAGELGVTTLAEGLELKNAGITAPVLSWLHTADS
DFAPAVAAGVELGLSSPRHLAAVAAAARQVGTAATVTVKVDTGLNRNGVSREEWTDFLKD
LARVEAEGAVRFKGVFSHLAHADEPHHPVIDDQRERFTSALEDAERIGLVPEAAHLSNSA
ATLTRPDLRFDMVRPGIAIYGLSPVPDLGTFGLRPVMTFRSRVALVKKVAAGEGVSYGHT
WVAPHDTTVALLPVGYADGIPRALGGRFEVWLGDDRRPGIGRVCMDQVVVDLGPDGAGVR
EGDTAVFFGDGDGDRGVPHAQDWADALDTIHYEVVTSVRGRTIRTYVGGPGGRS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggatcgaagttcgtgaccactaccgcgcaggagcccgacaccgccccgacccag
acgagcgcccccgtggcggcgaatacgcctccatctgcggcggcgcctcaggcggaagcg
gtgatcgacctcgacgcggtggcctacaacatcggcatcctgcgtgagcacgcgggcggc
gccacggtcatggcggtcgtcaaggccgacgcctacaaccacggtgccgtaccggtcgcg
cgggctgcgttggcagccggtgccggagaactcggtgtcacgacgcttgccgagggactc
gaactcaagaacgccggcatcaccgcacccgtgctgtcgtggctgcacaccgcggactcg
gacttcgcccccgcggtcgctgccggggtggaactggggctgtcgtcgccgcggcacctg
gctgccgtcgccgcggcggcccgtcaggtcggcaccgccgcgaccgtgacggtcaaggtc
gacaccggcctcaaccgcaacggtgtgtcccgcgaggagtggaccgacttcctgaaggat
ctcgcgcgcgtcgaggcagagggcgcggtccgcttcaagggcgtgttctcccacctcgcg
cacgcggacgagccgcaccacccggtcatcgacgaccagcgcgagcgtttcacgagtgcc
ctcgaggacgccgagcgcatcggtctggtccctgaggcggcgcacctgtcgaactcggcg
gccaccctcacccgtcccgacctgcggttcgacatggttcggcccggaatcgcgatatac
ggactgtccccggttccggacctggggacgttcggcctgcggccggtcatgacgttccga
tcgagggtggcactggtgaagaaggtggcggcaggagagggcgtctcctacgggcacacg
tgggtggcgccgcacgacacgacggtggcgttgcttccggtcggctacgcggacgggatc
ccgcgcgcgctgggcggtcgtttcgaggtgtggctcggcgacgatcggcgtcccggaatc
ggccgggtctgcatggaccaggtggtcgtcgacctcggaccggacggcgcgggagtccgg
gagggcgataccgcggtgttcttcggcgacggtgacggtgaccgcggcgtgccccacgcg
caggactgggcggacgcgctcgacaccatccactacgaggtggtgacgtcggtacggggc
cggacgatccggacctatgtcggaggcccgggcggccggtcatga

DBGET integrated database retrieval system