KEGG   Rhodococcus hoagii: REQ_40510Help
Entry
REQ_40510         CDS       T01352                                 

Definition
(GenBank) putative D-amino-acid transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
req  Rhodococcus hoagii
Pathway
req00220  Arginine biosynthesis
req00250  Alanine, aspartate and glutamate metabolism
req00290  Valine, leucine and isoleucine biosynthesis
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01130  Biosynthesis of antibiotics
req01210  2-Oxocarboxylic acid metabolism
req01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    REQ_40510
   00290 Valine, leucine and isoleucine biosynthesis
    REQ_40510
   00220 Arginine biosynthesis
    REQ_40510
Enzymes [BR:req01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     REQ_40510
    2.6.1.66  valine---pyruvate transaminase
     REQ_40510
Amino acid related enzymes [BR:req01007]
 Aminotransferase (transaminase)
  Class I
   REQ_40510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CBH50027
UniProt: E4W9A2
LinkDB All DBs
Position
4293278..4294540
Genome map
AA seq 420 aa AA seqDB search
MEAVSTPEPARPRRPHRALEQSTKLQNVLYEIRGPVHAHAARLEAEGHRILKLNIGNPAP
FGFEAPDVIMRDMIAALPYAQGYSESKGILSARRAIVTRYELVPGFPELDVDDIYLGNGV
SELITMTMQALLDDGDEVLIPAPDYPLWTAMTSLSGGTPVHYLCDEQNDWNPDIADIESK
ITDKTKALLVINPNNPTGAVYSAEVLTQLVDLARRHQLLLLADEIYDKILYDDAKHISLA
TLAPDLLCLTFNGLSKAYRVAGYRSGWVAITGPKEHAAGFLEGLDLLASTRLCPNVPGQH
AIQVALGGHQSIEDLILPGGRLLEQRDVAFERLNMIPGVSCVKPRGALYAFPRLDPNVYE
IHDDEKLVQDLLLQEKILMVQGTGFNWPNHDHLRIVTLPWARDLAVAIERFGNFLSSYKQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtgagcactccagaacccgcccgtccccgccggccgcatcgcgctctcgag
cagtccaccaagctgcagaacgtgctgtacgagatccgcgggccggtacacgcgcacgcg
gcgcggctggaggcggaggggcaccggatcctcaagctcaacatcggcaacccggcaccg
ttcggcttcgaggcccccgacgtgatcatgcgcgacatgatcgcggctctgccctacgcg
cagggttattcggagtcgaagggcatcctctcggcgcgccgtgcgatcgtcacgcgctac
gagctggtgcccgggttcccggagctggatgtcgacgacatctacctgggcaacggcgtc
tccgagctcatcacgatgacgatgcaggccctgctcgacgacggcgacgaggtgctcatc
cccgcgccggactacccgctgtggacggccatgacgagcctgtccggcggcacaccggtg
cactacctgtgtgacgagcagaacgactggaacccggacatcgcggacatcgagtccaag
atcaccgacaagaccaaggcgctgctggtcatcaatccgaacaacccgacgggcgcggtg
tactcggcggaggtcctcacacagctcgtcgacctggcccgcaggcaccagctgctgctg
ctggcggacgagatctacgacaagatcctctacgacgacgccaagcacatctcgttggcc
acgctcgctcccgatctgctctgtctgacgttcaacgggctgtcgaaggcgtaccgcgtc
gccggctaccgctcgggctgggtcgcgatcaccggacccaaggaacacgcggccggcttc
ctcgagggcctggacctgctcgcgtcgacgcgcctgtgccccaacgtccccggtcagcac
gcgatccaggtggcgctcggcgggcaccagagcatcgaggatctgatcctgccgggcggg
cgtctgctcgagcagcgagacgtcgcgttcgagcggctcaacatgatccccggcgtctcg
tgcgtgaagccgcgcggtgcgctgtacgcgttcccgcgcctcgacccgaacgtgtacgag
atccacgacgacgagaagctggtccaggacctgctgctgcaggagaagatcctgatggtc
cagggcaccggcttcaactggccgaaccacgaccacctgcgcatcgtcacgctgccgtgg
gcgcgtgacctcgcggtggcgatcgagcggttcggcaacttcctgtcgagttacaagcag
taa

DBGET integrated database retrieval system