KEGG   Rhodococcus hoagii: REQ_41210Help
Entry
REQ_41210         CDS       T01352                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
req  Rhodococcus hoagii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBH50091
LinkDB All DBs
Position
4382926..4384374
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLFIGGRWVAPATDQRLEVFSPATEERVGSVPVAAPADIDAAVAAARAAFESGAW
AETTPAQRGEILAKAAKLIEERSAELISTISDEMGAPASGVETMQKIMSLATLNYYANLA
NEFAWEETRNGAFGQTKVYREPVGVVGAVVAWNVPLFLAVNKLAPALLAGCTVVLKPAPE
TPLNANMLADIFTEAGLPEGVLSVVPGGAETGEYLVSHPDIDKVTFTGSTAVGRKIGAIA
AEQLKRCSLELGGKSAAILLEDMDVAATMPMLVMSGLMNTGQACVGQTRILAPRSRYDEI
IEAMVQFAGFMPVGMPDDPGAQLGPIITEKQRDKVLGYIEKGKAEGARVVLGGGVPAGLE
KGWFVEPTIFADVDNSMTIAREEIFGPVLAVIPYDTVDEAVKIANDSDYGLAGSVYTTDI
EKGLEVAKQIRTGTYAINWYAFDPGSPFGGYKNSGIGRESGPEGLEAYCELKSVLMPPGY
TG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaaactcttcatcggcggacgatgggtcgcgccggccaccgaccag
cggttggaggtgttctcccccgccaccgaggagcgcgtcggcagtgttcccgtcgccgca
cccgcggacatcgacgccgccgtcgccgcggcccgggccgcgttcgagtccggcgcatgg
gccgagaccaccccggcccagcgcggcgagatcctggccaaggccgccaagctcatcgag
gagcgcagcgccgaactgatctccaccatctccgacgagatgggcgcgccggcgtccggc
gtcgagacgatgcagaagatcatgtcgctggcaacgctcaactactacgcgaacctggcg
aacgagttcgcgtgggaggagacccgcaacggcgcgttcgggcagaccaaggtctaccgc
gagccggtcggtgtcgtcggcgccgtcgtggcgtggaacgttcccctgttcctcgccgtg
aacaagctggccccggccctgctcgcaggttgcaccgtggtgctcaagccggcgccggag
accccgctcaacgcgaacatgctcgccgacatcttcaccgaggccggtctgcccgagggc
gtcctgtcggtggttccgggcggcgccgagaccggcgagtacctcgtctcgcacccggac
atcgacaaggtcaccttcaccggcagcaccgccgtgggccgcaagatcggcgccatcgcc
gccgagcagctcaagcgctgctcgctcgagctcggcggcaagtccgccgcgatcctgctc
gaggacatggacgtcgccgcgaccatgccgatgctggtgatgtcgggcctgatgaacacc
ggtcaggcatgcgtcggccagacccgcatcctcgcgccgcgttcgcgctacgacgagatc
atcgaggccatggtccagttcgccgggttcatgcccgtcggcatgccggacgatccgggc
gcccagctcggcccgatcatcaccgagaagcagcgcgacaaggtcctcggctacatcgag
aagggcaaggccgagggtgcgcgcgtcgtgctcggcggcggcgtcccggccggactggag
aagggctggttcgtcgagccgaccatcttcgccgacgtcgacaactcgatgacgatcgcc
cgcgaggagatcttcggacccgtgctggcggtgattccctacgacaccgtcgacgaggcc
gtgaagatcgcgaacgactcggactacggcctggccggttcggtgtacaccaccgacatc
gagaagggcctcgaggtcgccaagcagatccgcaccggcacgtacgcgatcaactggtac
gcgttcgatccgggttcgccgttcggcgggtacaagaactccggcatcggccgcgagagc
ggacccgagggactcgaggcgtactgcgagctcaagtccgtcctgatgccccccggctac
accggctag

DBGET integrated database retrieval system