KEGG   Rhodococcus erythropolis PR4: RER_11020Help
Entry
RER_11020         CDS       T00881                                 

Definition
(GenBank) probable aldehyde dehydrogenase
Organism
rer  Rhodococcus erythropolis PR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAH31810
NITE: RER_11020
UniProt: C0ZRR0
LinkDB All DBs
Position
complement(1225401..1226846)
Genome map
AA seq 481 aa AA seqDB search
MTDYDKLYIGGAWVAPATDQVLEVFSPATEERVGSCPIAAPADIDAAVSAARAAFEGPWS
RTTPAERGAILAKAAKLIEERSAEINQLISNEMGQPPAMVGMMQQTPSMATLGYYAELAD
KFAWEEKRTGAFGQTKVTREPVGVVAAVLAWNVPLFLAINKLAPALLAGCTVLLKPAPES
PLSVHVIAEIFTEAGVPEGVISVLPGGAETGEYLVSHAGIDKITFTGSSAVGRKIGAIAA
QNLKRCSLELGGKSAAIILEDADIAAGMPMLVMSGLMNTGQACVAQTRILAPRSRYDEVI
EGMKTAAGFMTVGDPSDPAAQLGPLISEKQRERVEGYIAKGKEEGARVVLGGGRPAGLDK
GWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVWTTDID
RGLEVAAQIRTGTYAINWYAFDPGSPFGGYKNSGIGRENGPEGLEAFCETKSVLMPPGYV
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgacaagctctacatcggtggagcatgggtggccccggccaccgaccag
gtactcgaagtgttctctcccgcaacggaggagcgtgtcggcagctgtcccatcgcagca
ccggcagacatcgacgcggccgtgtccgcagcccgcgcggcgttcgagggaccgtggtca
cgcaccacgcccgccgagcgcggcgcgatcctcgccaaggccgccaagctgatcgaagag
cgcagcgcggaaatcaaccagctcatctccaacgagatgggccagccgcccgccatggtc
ggcatgatgcagcagaccccgtcgatggcgacgctgggctactacgccgagctggccgac
aaattcgcgtgggaagagaagcgcaccggtgcgttcgggcagaccaaggtgacccgtgag
cccgtcggcgtcgtcgccgccgtgctggcctggaacgtcccgctgttcctggcgatcaac
aagctggcccccgcgctgctcgccggctgcaccgtactgctcaagcccgcacccgaatcc
cctctctccgtccacgtgatcgccgagatcttcaccgaggcaggcgttcccgaaggcgtc
atctccgtgctccccggcggagccgagaccggcgaatacctggtctctcatgcgggcatc
gacaagatcacgttcaccggatccagcgccgtcggccgcaagatcggtgccatcgccgcg
cagaacctcaagcgctgctccctcgaactgggtggcaagtccgccgcgatcatcctcgag
gacgccgacatcgccgccggaatgccgatgctcgtcatgtccggcctgatgaacaccggc
caggcctgtgtcgctcagacccgaatcctcgctccccgttcgcgttacgacgaggtcatc
gagggaatgaagaccgcggcaggcttcatgaccgtcggcgatccgtccgatcccgcagca
caactcggcccgctgatctccgagaagcagcgcgagcgcgtcgagggctatatcgccaag
ggcaaggaagaaggcgcgcgcgtcgtactcggtggtggacgtcccgccggcctggacaag
ggctggtacgtcgagccgacgatcttcgccgacgtggacaactcgatgaccatcgcacgc
gaggagatcttcggacccgtcctctcggtgatcccgtacgactccgaggacgaggccatc
aagatcgccaacgattcggattacggcctcgccggatcggtgtggaccaccgacatcgat
cgcggactcgaagttgccgcgcagatccgcacgggtacctacgcgatcaactggtacgcc
ttcgatcccggatcaccgttcggtggttacaagaactccggtatcgggcgcgagaacgga
cctgagggcctcgaagccttctgcgagaccaagtccgtactcatgccgcccggctacgtg
ggctga

DBGET integrated database retrieval system