KEGG   Rhodococcus erythropolis PR4: RER_20050Help
Entry
RER_20050         CDS       T00881                                 

Gene name
icd
Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00020  Citrate cycle (TCA cycle)
rer00480  Glutathione metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
rer01210  2-Oxocarboxylic acid metabolism
rer01230  Biosynthesis of amino acids
Module
rer_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_20050 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RER_20050 (icd)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RER_20050 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAH32713
NITE: RER_20050
UniProt: C0ZWH8
LinkDB All DBs
Position
2193606..2194829
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSAPIEHELVNFPEEGGVVQ
GQYNFTTSIRDFARASLTYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKAEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDSTPEVIGFAQALE
DVVIKTVESGQMTKDLSMLVGGDQGYLTTEEFLGALDVNLQKAMAAK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggcaccgtcgtcgaactcgacggcgatgagatgacgcgc
attatctggcagttcatcaaagacaagttgatccatccgtatctcgatgtgaacctcgag
tactacgacctcggtatcgagtaccgcgacgagaccgacgaccaggtcaccatcgacgca
gcgcacgcgatccagaagcacggcgtcggcgtcaaatgcgccacgatcacgccggacgag
gcacgtgtcgaggaattcggtctcaagaagatgtggcgttccccgaacggaacgatccgc
aacattctcggcggcacgatcttccgcgcaccgatcatcatctccaacgttccgcgactc
gttccgggctggaccaagccgatcatcatcggccgtcacgcattcggcgaccagtaccgc
gccacagacttcaaggtccccggccccggcaaggtgatgatcacctacacgcctgaggac
ggcagcgcaccgattgagcacgaactggtcaacttccccgaagagggcggcgtcgtccag
gggcagtacaacttcaccacgtccatccgtgacttcgctcgcgcgtcgctcacctacgga
ctgcagcagaactacccggtgtacctgtccaccaagaacaccattctcaaggcgtacgac
ggtgccttcaaggacatcttccagcacgtctacgagaccgagttcaaggctgagttcgat
gccgcaggtctgacctacgagcaccgcctcatcgacgacatggtcgcttccgcactcaag
tgggagggtggatacgtctgggcatgcaagaactacgacggcgacgtccagtccgacacc
gtggcccagggcttcggctcgctcggcctcatgacgtcggttctgctgacaccggacgga
aggacctgtgaggcagaggctgctcacggcaccgtgacgcgtcactaccgtcagcaccag
cagggcaagcccacctcgaccaacccgatcgcgtccatcttcgcgtggacccgcggactc
gagcatcgtggcaagctcgacagcacccctgaggtcatcggcttcgcgcaggcgctcgaa
gacgttgtcatcaagaccgtcgaaagcggccagatgaccaaggacctctcgatgctggtc
ggcggcgatcagggctacctgaccaccgaggagttcctcggcgcactcgacgtgaacctg
cagaaggccatggccgcgaagtag

DBGET integrated database retrieval system