KEGG   Rhodococcus erythropolis PR4: RER_23890Help
Entry
RER_23890         CDS       T00881                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00010  Glycolysis / Gluconeogenesis
rer00030  Pentose phosphate pathway
rer00051  Fructose and mannose metabolism
rer00052  Galactose metabolism
rer00680  Methane metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_23890
   00030 Pentose phosphate pathway
    RER_23890
   00051 Fructose and mannose metabolism
    RER_23890
   00052 Galactose metabolism
    RER_23890
  09102 Energy metabolism
   00680 Methane metabolism
    RER_23890
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RER_23890
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RER_23890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: BAH33097
NITE: RER_23890
UniProt: C0ZXL2
LinkDB All DBs
Position
2580038..2581069
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRTSAGRYGSTVVGFRDGWRGLLEDRKVPLDSDDRINR
ILTRGGTILGTARVNPDKLRAGLDQIKQTLDDNGIDVLIPIGGEGTLTAASWLSESGVPV
IGVPKTIDNDIDCTDVTFGFDTALAVATDAIDRLHTTAESHQRVMLVEVMGRHAGWIALQ
AGLASGAHLTLVPEQPFDVDEVCAMVKKRFQRGDSHFICVVAEGAMPDPASMTLREGGID
EFGHKIFTGVAQQLGNEIERRIGKEVRTTVLGHIQRGGTPTPHDRILATRFGVHATDAAH
RGDFGQMVALHGTSIDLVPLAEATRKLKTVPKERYEEAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggaatcctcacgggcggcggcgactgcccgggcttgaacgcggtcatccgc
gccgtcgtacgtacgtcggccggtcgttacggcagtaccgtggtcggattccgggacggc
tggcgaggattgctcgaggaccgcaaggtcccgctcgactccgatgaccgcatcaaccgc
atcctcacccgcggcggcacgatcctcggcaccgctcgcgtgaaccccgacaaactccgt
gcgggcctcgatcagatcaagcagaccctcgacgacaacgggatcgacgtcctgatcccg
atcggcggcgaaggcacactcaccgcggccagttggctttccgagagcggcgtacccgtg
atcggtgtgcccaagacgatcgacaacgacatcgattgcactgacgtgactttcggtttc
gacaccgccttggctgtcgccaccgacgccatcgacaggctccacaccacggccgaatcg
caccagcgcgtcatgctcgtcgaggtcatgggccggcatgcgggctggatcgcgctgcaa
gccggactggcgtcgggggcacacctgactctggttccggaacagccgttcgacgtcgac
gaggtatgcgcgatggtcaagaagcgcttccagcgcggcgactcccacttcatctgcgtc
gtcgctgaaggcgcgatgcccgaccccgcgtcgatgaccctgcgcgaaggtggcatagac
gagttcggccacaagatcttcaccggcgtcgcgcagcagctcggaaacgagatcgagcgc
cgcatcggcaaggaagttcgcaccaccgtcctcggacacattcagcgcggcggcaccccg
acgccgcacgaccgcatcctcgccactcgcttcggcgttcatgccaccgacgcagctcac
cgcggagatttcggtcagatggtcgcgttgcacggaacgtccatcgaccttgttccgctc
gccgaggcgacccgcaaactcaagacggtgcccaaggagcgctacgaggaggcagccgca
ttcttcggctga

DBGET integrated database retrieval system