KEGG   Rhodococcus erythropolis PR4: RER_35380Help
Entry
RER_35380         CDS       T00881                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00250  Alanine, aspartate and glutamate metabolism
rer00410  beta-Alanine metabolism
rer00430  Taurine and hypotaurine metabolism
rer00650  Butanoate metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer02024  Quorum sensing
Module
rer_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RER_35380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RER_35380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RER_35380
   00430 Taurine and hypotaurine metabolism
    RER_35380
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RER_35380
Enzymes [BR:rer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RER_35380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAH34246
NITE: RER_35380
UniProt: C1A0W1
LinkDB All DBs
Position
3879068..3880459
Genome map
AA seq 463 aa AA seqDB search
MPEPRRSDHTDYVAVNPIFSRPGEDSVASKYTLEPDGMLPETAYQIVHDETMLDGNARLN
LATFVSTWMDDHATKLYTESFDKNMIDKDEYPQTAAIETYCWRILADLWHSPSPKDAIGT
STIGSSEACMLGGLAMKRRWQHARKAAGKSTEKPNLIMSSAVQVCWEKFCNYWDVEARYV
PISEEHRTLDGHDLDKYVDENTIGVIAIMGVTYTGMYEPVLEISKALDAIQEKTGLDVPI
HVDGASGAMIAPFLQPELEWDFRLPRVHSINTSAHKYGLVYPGLGWVVWRSQDLLPDDLV
FKVSYLGGSMPTFALNFSRPGAQVILQFYLFLRLGHDGYRAIQQSSQDVAKFLAEGIGKL
DAFELWNDGSDIPVFAWRLAEGHTSNWTLYDLSDRLRGKGWLVPAYPMPDDLADLTVQRI
VVRNGLSMDLAANLLRIIEEETAFLDELDSPMPRPRVTEGFHH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccagaaggtcagatcacaccgattacgtagccgtcaatccgatcttctcg
aggcccggcgaggattcggttgcatcgaagtacacactcgaacccgacggcatgcttccc
gagaccgcctatcagatcgtccacgacgaaacgatgctcgacggcaatgcgcggctcaat
ctcgcgacgttcgtcagcacgtggatggacgaccacgccaccaagctgtataccgagtcg
ttcgacaagaacatgatcgacaaggacgagtatccacagaccgccgcgatcgaaacctat
tgctggcgcatccttgccgacctctggcactcgccctcccccaaggacgcaatcggtacc
tcgacgatcggttcgtccgaagcgtgcatgctcggtggcctggcgatgaaacggcgctgg
cagcacgcacgaaaagccgcggggaagtccaccgaaaaaccaaatctcatcatgagttcc
gccgtccaggtgtgctgggagaaattctgcaactactgggacgtcgaggcgcgctacgtg
ccgatcagcgaggaacaccggaccctcgacggtcacgatctggacaagtacgtcgacgag
aacacgatcggcgtaatcgcgatcatgggtgtcacgtacaccgggatgtacgagccggtc
ctggaaatctcgaaggcactcgacgcgatccaggaaaagacgggactcgacgttcccatc
cacgtcgacggcgcttccggcgcaatgatcgccccgttcctacagccggaactcgaatgg
gatttccggctcccgcgcgtgcactccatcaacacctcggcgcacaagtacggactcgtc
tatcccggcctcggctgggtggtgtggcggtctcaggatctgcttcccgacgacctcgtg
ttcaaggtgagctacctcggcggcagtatgccgaccttcgcgctgaacttctcgcggccc
ggcgctcaggtgatcctgcagttctacttgttcctgcgtctcggccacgacggctatcgc
gcgatccagcagtcctcacaggacgtggcgaaattcctcgccgaaggaatcgggaaactg
gacgccttcgaactgtggaacgacggttccgacatcccggtcttcgcgtggcgcctcgcc
gagggccacacgtccaactggacgctgtacgacctgtccgaccgactgcggggcaagggc
tggttggtgccggcctatcccatgccggacgatctcgcggatctgacagtgcagcgcatc
gtggttcgtaacggactgagcatggacctggcagccaatctgctgcgcatcatcgaagag
gaaaccgcgttcctcgacgaactcgacagcccgatgccgcggccacgcgtcaccgaggga
ttccatcactga

DBGET integrated database retrieval system