KEGG   Rhodococcus erythropolis PR4: RER_45220Help
Entry
RER_45220         CDS       T00881                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rer00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RER_45220 (ligD)
Enzymes [BR:rer01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RER_45220 (ligD)
DNA repair and recombination proteins [BR:rer03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RER_45220 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: BAH35230
NITE: RER_45220
UniProt: C0ZMH2
LinkDB All DBs
Position
complement(4959100..4961376)
Genome map
AA seq 758 aa AA seqDB search
MATTDRGQITLDGTTVSVTNLGKIFYPESGTTKAEVIDYYTRIAAVMLPHVVGRPGTRKR
WPNGVDGQSFFEKNLASSAPQWLTRASLQHSDRVVTYPIFDSVASLAWLGQQAALELHVP
QWRFDGSERGPATRLVFDLDPGEGVGLAECAEVARSIRDLVATLGWTAYPVTSGSKGIHL
YVPLDRALDGSGASTVAKQIATGLEKLHPDLVTATMARNVRAGKIFVDWSQNNAAKTTIA
PYSMRGRDQPYVAAPRSWDELDDPKLRHLLFDEVLERVESDGDLLGDLDPPVSAAVADTL
AHYRNKRSADRTPEPIPAAVANETAGNTFVIQEHHARRLHYDVRLERDGVLVSWAVPKGV
PTSAGENRLAVHTEDHPLEYATFAGTIPKGEYGGGSMTIWDSGTYETEKWREDEVIVRLS
GERVQGRFALIRTKGDQWLMHLMKDQNASFGTEFPKNLEPMLATAGTLEGLDPQEWAFEG
KWDGIRVILEYRSGTMSLRSRAGNDKTRDYPALAGLAAVLDGHDVVLDGEVVAYNDAGVT
DFGLLQRGGEPVFLAFDLLYLDGVSLLRKSYSDRRTVLNALAGKVGELEVPPQIEGTAEN
ALEVSTDAGWEGIVAKRRASVYLPGRRGSSWIKVKNWRTQEVVIGGWRTGQGNRAQGIGA
LLMGIPGEDGLTYVGRVGTGFSDRDLESLLAVLEPLRQKESPFEEELPADDRKGAVWVRP
ELVGEARFMDWTATGRLRHPSWRGLREDKKPGDVTGRE
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacggatcggggtcagatcactctcgacggcacaaccgtgtccgtgaccaat
ctgggcaagatcttctaccccgagagcggcaccacgaaggccgaagtcatcgactactac
acccgtatcgccgcagtcatgcttccgcatgtcgtcggtagacctggtactcgtaagcgt
tggcccaacggtgtggacggtcagtccttcttcgagaagaacctggcgtcgtctgccccg
cagtggctcacgcgtgcgtcgctgcaacattctgatcgcgtcgtcacttacccgattttc
gattccgttgcatccctggcgtggctggggcaacaggcggcactcgaattacacgttccc
caatggcgattcgacggttccgagcgtggtccggcgacacgactggtattcgatctcgac
ccgggcgaaggcgtcggattggccgagtgcgccgaggtggcgaggtcgattcgagatctg
gtcgcaactctggggtggactgcctatccggtaaccagtggtagcaagggaatccacctc
tacgtaccactggatcgagccttggacggcagtggtgcgtcgactgtcgccaagcagatc
gccaccgggctcgagaagcttcacccggatctcgtcaccgcgacgatggcgcgaaatgtc
cgggcaggcaagatcttcgtggactggagtcagaacaatgcagccaagaccaccattgcg
ccgtattcgatgcgcggtcgcgatcaaccctatgttgccgcgccgcgcagttgggacgaa
ctcgacgatccgaaactgcgccacctgctgttcgacgaggttctggagcgcgtcgaatcc
gacggtgatctgctgggcgatctggatccgccggtctcggcggctgtagccgatacgttg
gcgcactatcgcaacaagcggtcggccgaccggacaccggagccgatccctgctgcggtg
gccaacgagacagcgggcaatacctttgttattcaagaacatcacgccagacgattgcat
tacgacgttcgcctcgagcgggatggtgtgctcgtgtcctgggcagtcccgaagggtgtg
ccgaccagtgccggagaaaatcggttggccgtgcacaccgaagatcatccgctcgaatac
gccacgttcgcgggcacgattccgaagggggagtacggcggcggttcgatgacgatctgg
gattccgggacatacgagaccgagaagtggcgtgaagacgaggtgatcgtgcgcttgagt
ggggagcgggtgcagggacgcttcgcgctgatccggacaaagggtgatcagtggttgatg
catctgatgaaggatcagaatgcgagtttcggaacggagtttcccaagaatctcgagccg
atgcttgccaccgctggaacgctcgaaggtctcgacccgcaggagtgggccttcgaagga
aagtgggacgggattcgagtgattctcgaatatcgttcgggcacaatgtcgcttcgcagt
cgcgcgggtaacgacaagacccgggactatccagcccttgccgggttggccgcggtgctg
gacggtcatgacgtggttctcgacggtgaggtggtggcgtacaacgacgcgggagttaca
gatttcggcctcctccagcgaggtggggaaccggtgttcctggccttcgatcttctgtac
ctcgacggagtgtctttgctgcggaagtcctattcggatcgccgcaccgtgttgaatgcg
ttggcgggcaaggtcggtgagctcgaggtaccaccgcagatcgagggcacggcggagaac
gccttggaggtgagtaccgatgccgggtgggaagggattgtcgccaaacgtcgtgcatcg
gtgtaccttccggggcggcgggggtcgagttggatcaaggtgaagaactggcgcacccaa
gaggtggtgatcggtgggtggcgcaccgggcagggcaatcgagcgcaagggatcggggcg
ctgctcatgggaattccgggtgaggatggattgacctacgtgggacgcgtcggtaccggc
ttcagtgatcgtgatttggagtcactgcttgcggtgctggaaccgttgcgtcagaaggaa
agtccgttcgaggaggaacttccagcagatgaccgcaagggtgcggtgtgggtgaggcct
gaactcgtcggtgaggcgcggttcatggattggacggcgaccggacgccttcgccacccg
agttggcggggtctgcgggaggacaagaagccgggcgatgtcacagggcgagaatag

DBGET integrated database retrieval system