KEGG   Rhodococcus erythropolis PR4: RER_49300Help
Entry
RER_49300         CDS       T00881                                 

Definition
(GenBank) probable aldehyde dehydrogenase
Organism
rer  Rhodococcus erythropolis PR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAH35638
NITE: RER_49300
UniProt: C0ZPE2
LinkDB All DBs
Position
complement(5381211..5382656)
Genome map
AA seq 481 aa AA seqDB search
METRVEYTELFIGGAWVTPSGSGVIEVMSPHTERVIGSVPAASTADVDRAVEIARAAFDS
GEWTQTPLADRIAVVTRIKDAILARSEEFAALISRQNGAPASSAMRTQVLGAVAAYGAAC
AVAAQFPFEESRAGVGGPMLIRHEPVGVVAAIVPWNVPQLVIAAKLAPALLSGCAVILKP
APETPLDSNLLAEICSQAGLPKGVLTVLPAERDVSAYLVAHPGIDKVAFTGSVPAGKAIM
AAAAANLTRVTLELGGKSAAIVLEDADVDQALPNILAGSFANSGQACVALTRILLPVSRY
DEIAEKFAAAVAAMKVGDPTDPATVIGPMTSAAQQRRVLDYVGIGEAEGAKILTGGSVPE
GLSTGWYVEPTVFGNVDNSMRIAREEIFGPVVCLIPFEDEAHAIAIANDSDLGLSGAVWT
ADTEHGVEVARQIRTGTFSVNCQRFDVVGPFGGYKNSGVGREFGPEGLAAYLEAKSIFLP
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgtgtcgagtacacggaactattcatcggcggtgcatgggtgacgccgtcc
ggtagtggagtcatcgaggtgatgtcgccgcacacggagcgcgtgatcggttcggtccca
gcggcgtcgacggcggacgtcgaccgcgcagtggagatcgcgagggcggcattcgattcc
ggggagtggacacagacacctcttgctgatcgcatcgcggtcgtcactcgcatcaaggac
gcgatcctcgccaggagtgaggaattcgcagcgctgatctcgcggcagaacggtgctccg
gccagttcggcgatgcgcacccaggtgttgggagccgttgcggcctacggcgcggcgtgt
gccgttgcggcgcagttcccgttcgaagagtcgcgtgcgggcgtcggcggcccgatgttg
atccgtcacgaaccggtgggtgtcgtggccgcaatcgttccgtggaacgtgccacagttg
gtgatcgctgcgaaacttgctccggcactcttgagtggatgcgcggtgatcttgaaaccg
gctccggagacaccgctcgattcgaacttgctggccgagatctgttcacaggcagggctt
ccaaagggagtgctgaccgtcttgcctgccgaacgagacgtgagcgcttatctggttgcc
caccccggaatcgacaaggtggccttcaccggttcggtgccagcaggtaaggcgatcatg
gccgctgcggcggcgaatctcacgcgggtgaccctcgaactcggtggcaagtcggctgcg
atagtcctcgaagacgcagatgtcgatcaggcgctgcccaatatcttggccggatcgttc
gccaacagcggtcaagcctgcgtcgcgctgacgcgtattttgttgccggtcagcaggtat
gacgagatcgcggagaagttcgctgccgcagtcgcggcgatgaaggtcggcgatcctacc
gatccggcgactgtgatcggcccgatgacaagtgcggcgcagcagcgacgagtgctcgac
tatgtcggaatcggcgaggcagagggtgcgaagatcttgacgggagggtctgttccggag
gggctttcgactggctggtacgtcgaacccacggtcttcggcaacgtcgacaactccatg
cggattgctcgcgaggaaatcttcgggccggtcgtctgcctgattcctttcgaagacgaa
gcccacgcaatcgcgattgccaacgattccgatctaggactctccggagcggtctggacc
gcggacactgagcacggcgtcgaggtggcacggcagattcgcaccggcaccttctcggtc
aactgccaacgattcgacgtcgttggtcccttcggcggttacaagaattcgggagtgggg
cgcgaattcggcccggaaggtctggcagcgtacctcgaagccaagagcatcttcctccct
gcttga

DBGET integrated database retrieval system