KEGG   Rhodococcus erythropolis PR4: RER_49760Help
Entry
RER_49760         CDS       T00881                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
rer  Rhodococcus erythropolis PR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAH35684
NITE: RER_49760
UniProt: C0ZPI8
LinkDB All DBs
Position
complement(5428106..5429152)
Genome map
AA seq 348 aa AA seqDB search
MELPLMPPLAPMLAKAAATVPPQPESGDPTWSYEPKWDGFRAIIFRDGDEVVLGSRGGKD
LARYFPEAVEAVKSELPEKCVVDGELVVPREIDGVTRLSWEALSERIHPAASRVALLSEQ
TPAQFVGFDLLALGDRDVSIEDFGVRRALLLDCVGGGPSCHVTAATADSAEAMAWFETFE
GAGLDGVVAKKLAGPYLPNKREMIKVKHARTADVVLLGYRPHKSQPGIGSMLLGLFDGAE
LKMIGGASAFTAARRIELLAELEPLRLGDDVVAEGEASRWRSAADRSWIPLRPERVLEVA
YDQMEGERFRHAARFLRWRPDRVPDECTFDQLEVPVRYDFADVLAGGK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacccctgatgccgccgcttgccccgatgctcgcgaaggctgcggccactgtg
ccgcctcagcccgagtccggtgacccgacgtggtcgtacgagccgaaatgggacggattt
cgagcaatcatctttcgtgacggtgacgaagtggtgctcggatcgcgaggaggaaaggac
ttggcgcggtactttcccgaggcggtggaagccgtcaagtctgaattgcccgaaaaatgt
gtggtggacggagaactggtggttccccgtgagatcgacggtgtgacgcgcctgagttgg
gaagcgctctccgagcggattcaccccgccgcgagccgcgtcgcattgttgtcggaacag
acgcccgcgcaatttgtcgggttcgatttactggcgctcggggatcgcgacgtctcgatc
gaggacttcggtgtgcgacgtgcgttgctcctcgattgcgtcggtggcgggccgagttgc
cacgtcacggcagcgacggcagacagcgccgaagcaatggcctggttcgaaaccttcgaa
ggcgcgggcctcgacggggttgtcgccaagaagctggcgggaccgtacctgccgaacaaa
cgcgagatgatcaaggtgaaacacgccaggaccgcggatgtcgtactgctgggctaccgt
ccacacaagagccagccgggtatcgggtcgatgcttctgggtctgttcgacggtgccgaa
ttgaagatgatcggtggcgcttcggctttcaccgcggcgcggcggatcgagttgttggcc
gaactcgaacctttgcgcctcggggacgacgttgtggccgagggagaggccagccggtgg
agatcggccgcagaccgctcctggattccgcttcgtcctgagcgggtgctggaagtggcg
tacgaccagatggaaggggaacgctttcggcacgccgcgcggttcctgcgctggcgtccg
gacagggtgcccgacgaatgcactttcgatcagttggaggttccggtgcgatacgacttc
gcggatgttcttgcaggtggtaagtga

DBGET integrated database retrieval system