KEGG   Rhizobium etli CFN 42: RHE_CH02260Help
Entry
RHE_CH02260       CDS       T00317                                 

Definition
(GenBank) putative trehalose synthase (glycosyl hydrolase) protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00500  Starch and sucrose metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_CH02260
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RHE_CH02260
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RHE_CH02260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABC91040
RhizoBase: RHE_CH02260
UniProt: Q2K7Z6
LinkDB All DBs
Position
2359961..2361622
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVESFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFEDARSDPH
SRYREWYVWSDKKPANADQGMVFPGVQKTTWTYDEKAKGYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGAEVTKPVEQFDMLRKFREFLQWRLGDSIV
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQTLFYALATADTRPLKKAMDATKPRPATA
QWGLFLRNHDELDLGRLTDKQRDAVFAAFGPEKEMQLYDRGIRRRLAPMLGGDRRRIELA
YSLLFSLPGTPVIRYGDEIGMGDDLCLPERNCARTPMQWSTEPEGGFTKSAKPVSPVIKD
GPYGFEHINVAAQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSAVDTGDDGVLALRYDWR
GNSVLILHNLHPHPTEVTFDPDVGELGRLLIDIADGASSEADENGRHTVVLDAYGYRWYR
VGGLDYLLRRKDI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgccgtcatctactgcctgtccgtcgagagcttc
atggatgcgaacggcgacggtgtgggcgatttccagggcctgatgcgccgtctcgactat
ctctccggcctcggcgtgacggcgatctggctcatgccgttccagacgtcgcccggtcgg
gacgacggctacgacgtctccgattactacaatgtcgacccacgctatggctcgctcggc
gatttcgtcgagttcacccatggtgccaaacagcggggcatccgggtgttgatcgatctg
gtgatcaatcacacctccaaggatcatccctggttcgaagacgctaggagcgacccgcat
tcacgctatcgcgagtggtacgtctggtcagacaaaaagcccgccaacgcggatcagggc
atggttttcccgggcgtccagaaaaccacctggacctatgacgaaaaagccaagggctat
tattttcaccgcttctacgatcaccagcccgatctcaacacgtccaatcccgaggtgcag
gcggagatcctcaagatcatgggcttctggatccagctcggcgtctcgggcttccgcatg
gacgccgcccccttcatcatcgccaccaagggcgcagaggtcaccaagccggtcgagcag
ttcgacatgctgaggaaatttcgcgaattcctgcaatggcgactgggagattccatcgtg
ctggcggaggccaatatcctgccgaaggacaatttcgaatatttcggcgacgatggcgac
cgcatgcagatgatgttcaatttccaggtcaaccagacgctgttttatgctctcgccacg
gccgacacgcggcctctgaagaaggctatggatgccacgaagccgcgcccggcaaccgcg
caatggggtctatttcttcgcaaccacgatgaactggatctcggtcgcctgacggataag
cagcgcgatgcggtattcgcggcatttggacccgagaaggaaatgcaactttacgacagg
ggcattcgccgtcgcctggcgcctatgctcggcggcgaccgccgcaggatcgagttggcc
tacagcctgctgttctcgctgcccggaacgccggtcatccgctacggcgatgaaatcggc
atgggcgatgatctgtgcctgccggagcgcaattgcgcgcgcaccccgatgcaatggtcg
acggaaccggaaggcggtttcaccaaaagcgcgaagcccgtttcgcctgttatcaaggac
ggcccctacggcttcgagcatatcaatgtcgccgcccagcggcgcgacccgaattcgctc
ttgaactggaccgagcggatgatccggatgcgcaaggaggctcccgagatcggttggggc
gatttctcagcggtcgacacaggtgacgacggcgtactggcgctgcgttatgactggcgc
ggcaattcggtgctgatcctgcacaacctgcatccgcacccgacggaagtgaccttcgat
cctgatgttggtgaactcgggcgactgctgatcgatattgccgatggggcaagtagcgaa
gccgacgaaaacgggcgccatacggtcgtgctcgatgcctatggctaccgctggtatcgc
gtcggcggtctcgactatctcctcaggcggaaagatatttag

DBGET integrated database retrieval system