KEGG   Rhizobium etli CFN 42: RHE_CH02965Help
Entry
RHE_CH02965       CDS       T00317                                 

Definition
(GenBank) probable L-iditol 2-dehydrogenase protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00040  Pentose and glucuronate interconversions
ret00051  Fructose and mannose metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHE_CH02965
   00051 Fructose and mannose metabolism
    RHE_CH02965
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     RHE_CH02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABC91732
RhizoBase: RHE_CH02965
UniProt: Q2K604
LinkDB All DBs
Position
3100716..3101744
Genome map
AA seq 342 aa AA seqDB search
MKAVRLQATGQLRLCEVEKPAPGPGELLVRVEACGICGTDRHIFHGEFRSKPPVTLGHEF
AGIVETVGPGVTDFRPGMRVTGDPNISCGGCEECRRGRVNLCRNLQAIGIHRDGGFADYV
CMPQSQAFALPADLDPLHGAFCEPLACCIHGVDLAGLHAGASVIVLGGGVIGLLTLQLAR
LAGATRLVLVTRSREKRRLAESLGATATADPGDGDVIAHITAADGPLPGGADVVFECAGV
TETMQQAPRLARRGGSAVILGVMPQGARIEVEPFDLLFREVRLIASFVNPFTHGRAADLI
ATGRIKVEPLISRRIGLSEAPDAIINPARGGEIRALVIPGRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgcgcctgcaagcgacaggacagttacggctttgcgaagtcgaaaagcca
gcacccggccccggcgaattgctggtccgcgtcgaagcctgcggcatctgcggcaccgac
cgccatatcttccacggcgaatttcggtcgaagccgccggtgacgctcggccatgaattc
gcaggtatcgtcgagacggtcggaccgggcgtgaccgatttccggcccggcatgcgcgtg
accggcgatccgaacatttcctgcggcggctgcgaggaatgccgccgcggccgggtcaat
ctctgccggaacctgcaggcgatcggcattcaccgcgacggcggctttgccgattatgtc
tgcatgccgcaaagccaggccttcgcactgccggccgatcttgacccgctccacggcgcc
ttctgcgagcccctcgcctgctgcattcacggcgtcgacctcgcaggattgcatgccggc
gcttcagtcatcgtgctcggcggcggcgtgatcggcctgctcaccctccagctggccagg
cttgccggcgcgacgcgcctcgtgctggtgacgcggagccgcgaaaaacgccgcttggcc
gaaagcctcggcgccaccgcgacggctgatcccggtgacggcgatgtcattgcccacatc
actgccgcagacggaccgctgcccggcggcgccgacgtcgtcttcgaatgcgccggcgtc
actgaaaccatgcagcaggcgccccggcttgcccgccgcggcggcagcgccgtcattctc
ggcgtcatgccgcagggggcaaggatagaagtcgagcccttcgacctgctgtttcgcgaa
gtccggctgatagcctccttcgtcaacccttttacccatggccgcgccgccgatttgatc
gccaccggcaggatcaaggtcgagccgttgatctcccgaaggatcggactttcagaagcc
ccggacgcgatcatcaatccggcgcgcggcggcgaaatccgggcgctcgtcatccccgga
cgaaaatag

DBGET integrated database retrieval system