KEGG   Rhizobium etli CFN 42: RHE_CH03282
Entry
RHE_CH03282       CDS       T00317                                 

Gene name
malL
Definition
(GenBank) oligosaccharide alpha-1,6-glucosidase protein
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00052  Galactose metabolism
ret00500  Starch and sucrose metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    RHE_CH03282 (malL)
   00500 Starch and sucrose metabolism
    RHE_CH03282 (malL)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     RHE_CH03282 (malL)
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459 Alpha-amylase_C
Other DBs
NCBI-ProteinID: ABC92046
RhizoBase: RHE_CH03282
UniProt: Q2K540
LinkDB
Position
3445415..3447094
AA seq 559 aa
MDQSTIPLGGPARSPLQPKWWHTATVYQVYPRSFCDSNGDGIGDLPGITAKLDYLKKLGI
DIIWLSPIYKSPMDDNGYDISDYRDIAPEFGTLADFDQLVAEAKNRGIGIMLDLVVNHTS
DEHPWFLQSRQELDNLFRDFYIWRKPAPDGGPPNGLKSSFGGPAWTLDPATGEYYLHMFS
RRQPDLNWENEKVRTEIYDMMNWWLERGIAGFRMDVIDYIGKQADRELVKDGPHLHDYLQ
EMNAKTFGSRDILTVGEAWSATPGAALLYSGRERRELSMIFQFEHVTQQWDAVYGKWRPK
PFDLVKLKTVLSKWQLALSEDGWNSLFWGNHDLPRAVSRYGNVSGYHVESAKMLATVLHL
LKGTPFVYQGEEIGMTNVPFTSIEQYRDIETINMHRLHVEAGLSPEEFIRGANENGRDNA
RTPMQWSAAPYGGFSTGVPWIEVNPNYPKVNAEAAIRDEKSIWNHYRKLIALRKTHPIII
YGEYRSWLDQHPDVFVYTRTLDRSWIIVVANFTPRDIALSLPTELAINGECLICNYEPVH
MIGETVELKPYETFAIECK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggatcagtccacgataccgctgggaggtcccgcgcgatcgcctctccaaccgaaatgg
tggcatacggcaactgtctaccaggtctatccgcgcagcttctgcgactcgaacggagat
ggcatcggcgatcttcccggcatcacggcaaagctcgattacctgaagaaactcgggatc
gacatcatctggctgtcgccgatctacaagtcgccgatggacgataatggttacgacata
tccgactatcgggacatcgcccccgagtttggcacgctcgcagatttcgaccagttggtg
gctgaggcgaaaaatcgggggatcggcatcatgctcgacctcgtcgtcaaccacacatcg
gacgagcatccgtggtttctccagtcccggcaggagctggataacctgttccgcgacttc
tacatctggcgcaaaccagcgccggacgggggaccgcccaacggcctgaaatcctccttc
ggcgggccggcctggacgctcgatcccgccaccggcgaatattacctgcatatgttttca
cgccgccagccggacctcaattgggagaacgagaaggtacggacggaaatctacgacatg
atgaactggtggctcgagcgcggcattgccggctttcgcatggatgtcatcgactacatc
ggcaagcaggcggaccgggagctcgtcaaggacgggccgcatctgcacgattatctgcag
gagatgaatgccaagaccttcggcagccgcgatattctgacggtcggcgaggcctggagc
gccacacccggcgcagcgctgctctattccgggcgcgaacgccgggaactgtcgatgatc
ttccagttcgagcacgtcacccagcaatgggatgcggtctatgggaaatggcgcccgaag
ccgttcgacctcgtgaaactcaagaccgtcctcagcaagtggcagcttgctctatccgaa
gatgggtggaattcgctcttctggggcaatcacgatttgccgcgcgccgtctcgcgctac
ggcaatgtcagcggctatcacgtcgagtcggcgaagatgctggcgaccgtgttgcatctc
ctaaagggcacgcctttcgtctatcagggcgaggagatcggcatgacgaacgtccccttc
acctcgatcgaacagtatcgcgatatcgaaaccatcaacatgcacaggttgcatgtggag
gccggcctttcaccggaggagttcatccgcggggcaaacgagaacggccgcgataatgcc
cgcacaccgatgcaatggagcgccgccccctatggcggtttttccacaggcgtcccctgg
atcgaggtcaatcccaattacccgaaggtcaacgccgaagcggccatcagggacgaaaag
tcgatctggaaccattatcgcaagctgatcgctctccggaaaacccatcctatcatcatc
tatggcgaataccgctcctggctcgaccagcaccctgatgtcttcgtctatacccgcacg
ctcgacaggagctggatcatcgtggtcgccaacttcacacccagagacattgcgctgagt
ttgccgacggagctcgccatcaacggagaatgcctcatctgcaattatgaaccggtgcac
atgatcggcgaaactgttgagctcaagccgtacgagacctttgccatagagtgtaagtga

DBGET integrated database retrieval system