KEGG   Rhizobium etli CFN 42: RHE_CH03895Help
Entry
RHE_CH03895       CDS       T00317                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00020  Citrate cycle (TCA cycle)
ret00190  Oxidative phosphorylation
ret00650  Butanoate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Module
ret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ret_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHE_CH03895 (sdhA)
   00650 Butanoate metabolism
    RHE_CH03895 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RHE_CH03895 (sdhA)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RHE_CH03895 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RHE_CH03895 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABC92641
RhizoBase: RHE_CH03895
UniProt: Q2K3E5
LinkDB All DBs
Position
complement(4128706..4130547)
Genome map
AA seq 613 aa AA seqDB search
MAPTSPVQNGKAYKYVDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTRSHTVA
AQGGIAASLRNMTPDSWQWHLYDTVKGSDWLGDVDAMQYLTMEAPKAVYELEHYGVPFSR
NEEGKIYQRPFGGHMQNYGEGPPVQRTCAVADRTGHAILHTLYGQSLRNNAEFFIEYFAL
DLIMSEDGSRCTGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMV
ARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASR
DVVSRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPI
PVLPTVHYNMGGIPTNYWGEVLNADGANPERIIPGLMAVGEAGCASVHGANRLGSNSLID
LVVFGRAAAIRAGEVIDRAAPIPHLNVAACDKIMDRFDGLRHASGGTPTADLREKMQRAM
QEDAAVFRTQESLESGCRRISAIWQEMRDIKVTDRSMVWNSDLVETLELQNLMANAITTI
YGAEARKESRGSHAREDYTEGAFAGRDDVNWRKHTLAWVNEAGDVKLDYRPVHTELIAEG
IDPHKIEPKARVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgacttcacccgttcagaatggcaaggcctacaaatatgtcgatcactcctat
gacgtgatcgtcgtcggcgccggcggcgcgggcttgcgcgcgacgctcggtatggccgag
cagggtttccgcaccgcctgcatcaccaaggttttcccgacccggtcgcatacggttgct
gcccagggcggcatcgccgcctcgctgcgcaacatgacgccggatagctggcagtggcat
ctctatgataccgtcaagggttccgactggctcggcgacgtcgacgccatgcagtatctg
accatggaagcgccgaaggcagtctatgagctcgagcattacggcgtgccgttctcgcgt
aacgaggaaggcaagatctaccagcgccctttcggcggccacatgcagaattacggcgaa
ggtccgccggtgcagcgcacctgcgccgttgccgaccgcaccggccatgccatcctgcat
acgctctacggccagtcgctgcgcaataacgccgaattcttcatcgaatatttcgcgctc
gacctgatcatgtctgaggacggcagccgctgcaccggtgtcgtcgcctggtgcctcgat
gacggtacgatccatcgtttcgccgccaagatggtggtgctggcgaccggcggctacggc
cgtgcctatttctcggcgacctcagcccatacctgcaccggcgacggcggcggcatggtg
gcgcgcgccggcctgccgctgcaggacatggaattcgtccagttccacccgaccggcatc
tacggttcgggctgtctgatcaccgaaggcgcgcgcggcgaaggtggctacctcgtcaac
tccgagggcgagcgcttcatggagcgttatgcgccttcggccaaggatcttgcctcgcgc
gatgtcgtttcgcgctgtatgacgcttgagatccgcgaaggccggggcgtcggcaagaac
aaggaccacatcttcctgcatctcgaccatctcgatccggccgtgctgcatgagcgcctg
ccggggatttccgagagcgccaagatcttcgccggcgtcgacgtcacgcgcgagccgatc
ccggttctgccgaccgttcattacaatatgggcggcattcccaccaattattggggcgag
gtgctgaacgccgacggtgccaatccggagcggatcattcccggccttatggctgtgggt
gaagccggctgcgcctcggtgcacggcgccaaccgcctcggctcaaactcgctgatcgac
ctcgtggtcttcggccgcgccgctgcgatccgtgccggcgaggtgatcgaccgcgcagcg
ccgatcccgcatctcaatgttgcggcctgcgacaagatcatggaccgcttcgacggtctg
cgccacgccagcggcggcacgccgacggctgacctgcgcgagaagatgcagcgcgccatg
caggaagacgccgccgtcttccgcacgcaggaatcgctggaatccggttgccggcgcatt
tcggcgatctggcaggaaatgcgcgacatcaaggtcacggaccgatcgatggtctggaac
tcggatctggtggaaacgctggagctgcagaacctgatggccaacgccatcacgacgatc
tacggcgccgaggcccgcaaagagagccgcggttcgcatgcccgcgaggattataccgag
ggcgcattcgccggccgcgacgacgtcaactggcgcaagcatacgcttgcctgggttaac
gaggcaggcgacgtcaagctcgattaccggccggttcacaccgagctgatcgccgagggc
atcgatccgcacaagatcgagccaaaagctcgcgtctactga

DBGET integrated database retrieval system